CAZyme Information: MGYG000001621_01404

Basic Information

• Species: Pauljensenia sp900554605
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp900554605
• CAZyme ID: MGYG000001621_01404
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596		66361.16	6.4008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001621	1473621	MAG	China	Asia

• Gene Location: Start: 307; End: 2097 Strand: -

Full Sequence      

MRAEDLAHSDDSASAPPVAASQEKPESEADAQAADAGTTIDGDNEESASERGEESAEVES
SEEVSEAEARRWKPVAIPRWAQLPMSARAGWIATWVMTILAAFIRLPGLGTIRTLIFDET
YYVKDAYSQIALGYEGSWAKDTDPAFISGDFSGLSAEGGYVVHPSVGKWLIGLGMRVFGP
TNPVGWRISAAIAGIILVFLTARIAQHLFRSPAITALAGFFMATDGIAIVLSRTGLLDVF
LAMFAAAAFLAVLKDQEITHPRLVSRLSDWTPDPDDPKRIGPHAGSRWWLLAAGILSGLA
MSVKWSGLYVLAVLGLFVAVRDWMTRRRMGHPRAFSATLINDTSVAFLAMVPPAIITYIA
SWFGWFTHWNAYGHRNHGIAGAFQDLWDYHVGMFKFHTGLTTPHTYQAHPAQWFVQARPT
SFAWDKVASGACDKSDCVHAVLALGNPLLWWVGAVAFFILLFVTLRDRNWRTGFVVCGYL
ALYFPWYLNANRTIFNFYTIAFVPFVCLSVAWLLGYMLDQTRTWVDPDRMYDSQPLEPGD
YRWMGADAGVRQRWALGALVITALITACAVFFMPLWRGDLISYNFWHFHMWFPTWI

Enzyme Prediction     

No EC number prediction in MGYG000001621_01404.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	97	366	4e-64	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	7.45e-16	98	323	31	228	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	1.50e-13	384	593	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1807	ArnT	4.34e-12	85	403	1	269	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
COG4346	COG4346	1.95e-11	163	533	136	427	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	2.37e-10	95	323	1	201	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT34948.1	1.81e-195	80	596	58	581
QGS11599.1	3.85e-192	80	596	58	581
AKU65332.1	1.21e-191	80	596	61	584
QQC43974.1	1.71e-191	80	596	61	584
QWC16849.1	3.05e-135	84	596	110	622

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	1.68e-74	84	595	31	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	3.68e-66	84	595	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	3.68e-66	84	595	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	1.04e-56	94	595	37	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
95	117
183	205
209	231
236	253
298	320
344	366
448	465
472	489
494	516
554	576