CAZyme Information: MGYG000001622_00125

Basic Information

• Species: Enterocloster sp900549235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900549235
• CAZyme ID: MGYG000001622_00125
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		36723.04	5.1371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001622	3555335	MAG	China	Asia

• Gene Location: Start: 135520; End: 136500 Strand: +

Full Sequence      

MTEQHTYTVAQDGTGDFASIGEALHTIGTEGADPVRLFIKKGTYHERLEIRRPFLTLEGE
DAEETIITYGLYARMEMEDGMKRGTFRSYSVLIDTHDVTARSLTFRNHAGPGSQVGQALA
LYVDGDRILFENCRMEASQDTLFTGPLPPKEIEPNGFIGPKQHAPRINGRHCYRNCLIRG
DIDFIFGSATAYFEGCELFSNNIGKEINGYVTAASTPEGQEFGYVFKDCHFTSNCPPRSV
YLGRPWRNFAKTVLLNCRLEEHICLEGWHDWGKEAAHDTLYYAEWHSYGPGAADEKRPDW
VEILKDGGQEAYTIEKVLSGTDGWRP

Enzyme Prediction     

No EC number prediction in MGYG000001622_00125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	7	319	4.5e-89	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.73e-77	7	320	85	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.06e-64	8	300	3	274	Pectinesterase.
PLN02432	PLN02432	1.67e-54	8	324	14	291	putative pectinesterase
PLN02745	PLN02745	1.18e-50	8	320	288	581	Putative pectinesterase/pectinesterase inhibitor
PLN02301	PLN02301	1.63e-50	8	320	239	533	pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	1.14e-160	9	326	4	321
ANU50094.1	1.02e-154	8	326	18	348
QQR01004.1	1.02e-154	8	326	18	348
QIX89293.1	1.45e-154	8	326	18	348
QRP39805.1	4.06e-152	8	326	19	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	2.57e-39	9	320	7	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	4.64e-34	9	300	11	281	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	5.43e-32	17	326	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	3.82e-28	17	326	18	339	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]
3UW0_A	5.41e-28	4	318	30	358	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.84e-43	1	306	1	284	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q1JPL7	3.33e-43	9	320	249	542	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3
Q8GXA1	3.84e-43	9	326	260	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q43043	1.47e-42	8	324	60	359	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q5MFV6	6.55e-42	6	324	276	576	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001622_00125.