CAZyme Information: MGYG000001622_00741

Basic Information

• Species: Enterocloster sp900549235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900549235
• CAZyme ID: MGYG000001622_00741
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	MGYG000001622_2|CGC7	67099.41	4.5655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001622	3555335	MAG	China	Asia

• Gene Location: Start: 206379; End: 208262 Strand: +

Full Sequence      

MKGNEHKRPSSYRQRLLRRFRAAALAGLLGAGTLVPAFPALAVGPGEGGNTITTAGGPGA
ASAGTDSSQTAAPASDTSQTNPNAWKKSGGVYQMPDGSSIENVLARGIDVSRWQGEIDWS
QAAADDVSFVMLGTRSRGAVDPYFHRNIQQASAAGVKVGVYIYSLATTTDMAVQEANFVL
DLIHDYPVSYPVAFDMEDSTQGALSKDELAQIANAFCKTISDAGYYPIIYANDNWLANKL
DMSKMDYPVWVARYSAKPAYQNPVMWQATSTGSVKGISGNVDIDFQFQDFSSVIPANTWR
TIGGKTYYYQNYMKVKNGWAQDGSDWYYMDSDGLASKGWLTLSGNKYYLNADNGKMVTGW
QSDNGKWYYFGGSGAMDTGWINHKNTWYYSDSEGVMQTGWEDIDGQRYFFESSGAMATGW
TKQDDKWYYLSGTGALSKGWINDNGTWYYSDANGVMQTGWLDDGGERYYLRGSGAMASGW
REMDGAWYYFESSGRMAKGMIEVNGLHYYMDPSTGRMAASVQLDINGTAYQADGNGVLSQ
VQEGQAENGQQESVSQGDSSQAGTTVITPVDGNGSTGGSQTGPASGGQNSQVSTGSAPGS
NTGNSNGGSSIGHGVSGVNGGPGVSGS

Enzyme Prediction     

No EC number prediction in MGYG000001622_00741.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	108	277	1.8e-46	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	7.22e-81	106	287	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033930	pneumo_PspA	1.33e-64	295	497	441	643	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	3.63e-61	316	539	442	643	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.89e-56	316	536	485	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	1.54e-55	295	497	484	666	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR03194.1	9.24e-157	16	317	7	312
ANU47907.1	9.24e-157	16	317	7	312
QIX91481.1	6.42e-156	16	317	7	312
QRP37172.1	1.10e-150	16	317	7	312
QJU23033.1	1.10e-150	16	317	7	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	1.96e-14	106	284	21	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	9.52e-14	106	284	21	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	6.88e-09	106	282	6	198	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
3HMC_A	4.35e-07	108	284	8	177	Endolysinfrom Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	4.36e-15	107	284	69	252	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	5.89e-15	107	284	69	252	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	7.94e-15	107	284	69	252	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P34020	1.04e-09	106	284	2	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P25310	8.55e-08	106	282	83	275	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000631	0.998184	0.000251	0.000486	0.000233	0.000172

TMHMM  Annotations     

start	end
20	42