CAZyme Information: MGYG000001622_01106

Basic Information

• Species: Enterocloster sp900549235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900549235
• CAZyme ID: MGYG000001622_01106
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568	MGYG000001622_4|CGC1	64072.54	5.103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001622	3555335	MAG	China	Asia

• Gene Location: Start: 23616; End: 25322 Strand: +

Full Sequence      

MKKEYFFTDQMLENEIKDWRGNDFYTGTAGWIPGGNGTWLGSEGYPLRFGIKVPDIGLYQ
VEVEIPGGEEGLRGLTLCVGRRNIVERGICIPAGGVYRKTFYYGVYPYRPVVGRDDAVTD
DIIGLSVIGKGARLGRVCVKSCDDVGQDIPTLFIGGDSTVRDYEGCYPYNPLTNGGSWGQ
NLLQYMDKMAVCNQAHSGLTTNCFREDGHWELVKANLRPGDVFLFGFGHNDQKRRNLKPY
DQFAANIRQYVMETREMGAVPVLVTPMSRIPSRDQDGWYDLLEAYADSIRGVGREMGAAV
IDLHSLTFERFCAMGTEGCQNYFNDTTHVNDYGGALLADLMAREIRRLRIEPLYSHMNNR
AVARWEPDLSLRPDHRAESSQAEERPNLSHDLAELPYVDCRTLPEKEAEVLKKAMAYGLL
DPCVRYLHPHEEMPRAQFVFLLLKAVNPARRRPWQGEYCDLSRYEFDAEQIQMALDEGLI
DPVTTPGKRFRPDDAITLGELVSFAVRGAKARGERELGMEECFREAGKWGWIGDEGEDGE
RRVTRGECIGMAVGVRERVSLYALQAVQ

Enzyme Prediction     

No EC number prediction in MGYG000001622_01106.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	151	345	2.1e-46	0.9952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	2.51e-57	150	345	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd00229	SGNH_hydrolase	1.03e-12	152	343	2	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01838	Isoamyl_acetate_hydrolase_like	2.30e-12	151	345	3	199	Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash. The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
cd01834	SGNH_hydrolase_like_2	9.10e-12	221	343	63	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
COG2755	TesA	2.02e-07	149	353	8	216	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS48637.1	8.72e-177	23	548	46	577
ASA21604.1	3.41e-165	37	549	74	576
AOZ96642.1	1.12e-102	47	544	43	535
ADL33886.1	3.84e-93	52	561	53	561
APC40119.1	8.45e-57	46	357	93	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O14_A	2.55e-23	118	356	127	370	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	2.31e-24	152	360	8	226	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
P42304	1.13e-22	118	347	142	376	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2
O31528	1.50e-19	152	348	5	205	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999938	0.000084	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001622_01106.