CAZyme Information: MGYG000001622_01186

Basic Information

• Species: Enterocloster sp900549235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900549235
• CAZyme ID: MGYG000001622_01186
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		45316.04	4.5092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001622	3555335	MAG	China	Asia

• Gene Location: Start: 106874; End: 108055 Strand: -

Full Sequence      

MKKWRLTALSFICTAAMAFPVQAGTWIPEGDTWKYQQEDGTLAVNRWIQDTDGRWYYLDQ
NGVMVRNYITPDGYVTGRDGAYITGMWQDGDSPVTPWDYQQLLGRGMDVDWSKTKEGRKW
YQAKAVEDFKAAGVDHVRIRVKDDLTPDILSSLDQQIEDCLSRGMIPILAYQADEFKNNP
CQETIDKVTGWWRTAAEHFQTKSHMLAFDLMIESSDELNKQPEMLNQMIEQTVTAIRQSN
PDRILIMSPRLRSDPMYLSELNIPTMANGYMMAEWHFYASGPSKTNERKKWTTGTDSERN
LIQEKIGYALRWQEETGIPTWVGAWMPGNYNDENNYTLSEQMEFASFMCNSLEAAGIPFA
VNSDTKFYDRENGVWLEAMAPLRQLIWADQPLT

Enzyme Prediction     

No EC number prediction in MGYG000001622_01186.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	121	361	3e-26	0.9580152671755725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.47e-10	129	345	33	256	Cellulase (glycosyl hydrolase family 5).
NF033838	PspC_subgroup_1	1.59e-07	23	132	545	647	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033840	PspC_relate_1	3.95e-07	23	125	529	625	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
COG5263	COG5263	1.60e-05	26	83	257	313	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033930	pneumo_PspA	1.84e-05	23	121	542	634	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB28168.1	1.49e-142	91	390	2	301
QCI58964.2	1.41e-133	91	392	28	329
QUF84801.1	3.38e-129	93	382	28	317
QMW91197.1	4.78e-129	93	382	28	317
BBK76626.1	4.78e-129	93	382	28	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U5I_A	5.21e-18	94	372	76	366	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5I_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_A Chain A, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
4U3A_A	2.32e-17	94	372	76	366	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U3A_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
5BYW_A	2.78e-15	94	372	76	377	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_C Chain C, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_D Chain D, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_E Chain E, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
4YZP_A	2.38e-06	127	375	61	318	Crystalstructure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]
6KDD_A	5.03e-06	98	380	15	314	endoglucanase[Fervidobacterium pennivorans DSM 9078]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16218	2.94e-16	94	372	327	617	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000309	0.998783	0.000276	0.000204	0.000194	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001622_01186.