CAZyme Information: MGYG000001622_01936

Basic Information

• Species: Enterocloster sp900549235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900549235
• CAZyme ID: MGYG000001622_01936
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	MGYG000001622_11|CGC1	56451.81	5.2475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001622	3555335	MAG	China	Asia

• Gene Location: Start: 50518; End: 51984 Strand: +

Full Sequence      

MNTPFHMLWGSASADFQYEGGFGEGGRGLLTHDIVTDGSHEVPRRITYRMPDGTPGWAAY
RHSLPEGAEGCIHEGEYYPSHSAADFYHRYKEDIKLLADMGLNVMRFGICWTRIFPTGEE
TEPNQQGLSFYENVIDECLKYGIEPMITICHDELPLHLANQYDGWSDRLLIDRYLRLCRV
LFERFGKKVKYWLTFNEVNVLQGFSHLGTRSSDAQTTWQAIHHLFVASAKAKLLAKELMP
EAMMGAMYATSPSYPRTCHPDDQLAWMAQRRRLFYFSDVMLRGYYPSYAQSIWDAYGVTI
RMEEGDEEILKAGTLDFYSFSCYRSTTVGREDELGIIALPFGQNPYLKATPWGWPIDPVS
IRYVLNEVYDRYQKPIFIVENGLGEIDQPDEEHFVNDTYRIDYLNDHFLEIKKAVEIDHV
PVLGYTMWGGIDLVSLSTGEMKKRYGFVYVDMDDKGNGTKNRYPKASYYWMKEFMETNGE
NLKENRGR

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	479	3.1e-131	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	3.92e-168	73	480	44	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	2.06e-166	8	482	9	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.43e-163	4	482	5	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	1.55e-163	74	482	59	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	7.93e-156	1	482	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM10803.1	0.0	1	488	1	490
QQV05163.1	0.0	1	485	1	485
QPS13348.1	0.0	1	485	1	485
QMW73394.1	0.0	1	485	1	485
QQY27830.1	0.0	1	485	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.27e-158	1	482	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	1.22e-148	4	482	9	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	2.62e-145	4	482	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	7.44e-145	4	482	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	3.23e-141	4	483	12	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	6.93e-158	1	482	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.59e-156	2	482	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P24240	7.29e-146	4	483	5	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	6.49e-143	4	482	9	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	3.24e-136	1	483	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001622_01936.