CAZyme Information: MGYG000001622_02850

Basic Information

• Species: Enterocloster sp900549235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900549235
• CAZyme ID: MGYG000001622_02850
• CAZy Family: PL22
• CAZyme Description: Oligogalacturonate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000001622_27|CGC1	44889.9	4.7998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001622	3555335	MAG	China	Asia

• Gene Location: Start: 26689; End: 27855 Strand: +

Full Sequence      

MIGTRYPSEKQVYTDSKTGAAITKLTSRGINYHFYFTENSFDLDGKTIYFLSNRGNEGTE
ICNLFSMDLESGEMVQLTDDPAGVEVGRITKTPDSEYIAYITGRQLRLYCTKTGENRLLW
EEPSMLMHNLSFSCDKQWIGFTRDEDVDALPDGGPNYAGFKEKMFATKDGRISMIDLNGE
NFHDVFRDTHWLGHFQFSPDDPEIAMFCHEGPWNYVQQRIWVINMRTGEVWPCFRQQEDD
CVGHEFWTRNGDIIFDNRRGGHDGTISNTKEQVYGSENVSRETPYFGFAHKDGTVYRRIE
MPYYCNHYFANQDLSLFVGDAVEDIVLIKPEEDGTARVKTLACHNTTWHYQRSHCHPTFS
WDGTKLLYAADTDQWHDNLFLAEVPKEI

Enzyme Prediction     

No EC number prediction in MGYG000001622_02850.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL22	172	369	1.1e-19	0.9137055837563451
PL22	33	145	3e-17	0.4075471698113208

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14583	Pectate_lyase22	4.97e-27	3	388	4	386	Oligogalacturonate lyase. This is a family of oligogalacturonate lyases, referred to more generally as pectate lyase family 22. These proteins fold into 7-bladed beta-propellers.
COG0823	TolB	2.20e-07	10	105	219	303	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
PRK03629	tolB	5.64e-05	40	121	249	329	Tol-Pal system protein TolB.
COG0823	TolB	5.90e-05	191	371	239	389	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
COG0823	TolB	1.17e-04	11	102	263	344	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR02694.1	3.87e-237	1	388	1	367
ANU48417.1	3.87e-237	1	388	1	367
SET71872.1	1.14e-183	1	384	1	382
AJQ29048.1	5.55e-133	1	383	1	381
AGK03506.1	4.90e-120	13	384	9	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PE7_A	1.74e-27	3	388	4	386	Oligogalacturonatelyase in complex with manganese [Yersinia enterocolitica subsp. enterocolitica 8081]
3C5M_A	1.52e-22	11	386	12	384	Crystalstructure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_B Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_C Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P21258	1.65e-25	13	388	14	386	Oligogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=ogl PE=2 SV=2
Q59418	3.10e-25	3	388	4	386	Oligogalacturonide lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=ogl PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001622_02850.