CAZyme Information: MGYG000001623_02969

Basic Information

• Species: Terrisporobacter othiniensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Terrisporobacter; Terrisporobacter othiniensis
• CAZyme ID: MGYG000001623_02969
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000001623_261|CGC1	65730.13	4.8223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001623	3867293	MAG	China	Asia

• Gene Location: Start: 3457; End: 5226 Strand: +

Full Sequence      

MVNLKAKPYYLDEEGISWVEETLNSMTIEEKIGQLFINMGSSTEEEYLKDVVNKYKFGAV
RYNPGTAEKVLEQNRILQENSKIPLLIAANAESGGNGAFMGGTEIGTPIKIGATRDAKYA
YEMGRVSGIECAAIGANWTFAPVTDIMLNWRNPVIQTRTFGDDADRVLEMSKAYMKGFME
SNGICAMKHFPGDGVDERDQHLSNSSNSLSCEEWDKTFGKVYSGMIDAGIHSIMVGHIML
PAYERKYNKSLDEDGEIMPATVSKAIITDLLKGQLEFNGLVVTDASHMAGLTSRMKRSDM
LPASIAAGCDLFLFFNDPDEDFGYMMDGYKNGIITDERLNDAIRRILGTKAYLGLHKKDK
KDIVPPKEGLSVIGSEEFKNIAREISDEAITLVKNVDKSILPISVEKNKRILLIEQEISN
PVMAMFVGAGNKKTSTEYFKEKLEAEGFEVEIYESPIDKVKKVSREEAGKIMMNAYSAKA
PITDLTDKYDLVIQLASVYNAGGTTQRIEWKMSKGTPDIPWYIHELPTIFVSLCSPFHLA
DVPQVKTYINCYDKNEHTLDALVEKLLGRCEFKGIDPVDSFCGLEDTRW

Enzyme Prediction     

No EC number prediction in MGYG000001623_02969.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	313	1.3e-51	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.45e-64	26	416	1	362	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.76e-58	27	347	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.74e-22	118	319	97	284	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.50e-21	19	414	38	416	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA10123.1	0.0	1	589	1	589
QFK71386.1	5.35e-271	2	587	4	586
CED94841.1	1.96e-266	1	589	1	586
ALC92197.1	1.03e-265	2	588	4	585
QQJ89971.1	1.47e-265	2	588	3	585

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	3.14e-142	4	588	6	566	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	1.69e-48	21	579	37	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.81e-48	21	579	11	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	8.78e-48	21	579	41	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	5.91e-38	25	577	10	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	7.32e-141	1	588	1	563	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	9.23e-48	21	579	37	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	8.20e-24	73	395	88	419	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A7LXU3	1.68e-23	19	413	39	439	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q7NWB7	8.86e-23	85	320	61	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001623_02969.