CAZyme Information: MGYG000001624_03152

Basic Information

• Species: Proteus cibarius
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus cibarius
• CAZyme ID: MGYG000001624_03152
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000001624_60|CGC1	40740.98	5.133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001624	3841359	MAG	China	Asia

• Gene Location: Start: 17392; End: 18453 Strand: +

Full Sequence      

MEHANTETLQRELVLQNMKRVYRYQSANQVRSVRRRSGKTRFIKDTDWERGVLWSCVSAA
WQATQDEEYLNGILNYTLHTGFRTGPNARFADDHVCAQAYLAISPLFEQPEVIEPTIKAF
DIMLNEPKPGREDWWWCDALFMAPPGFAALAEITNERRYLDYMHTAYWDAIDHLRDPETG
LIFRDHRYIPDGQGNELREANGEKVFWSRGIGWVLASIPRILKYMPDDYHGRERYIALFK
ELATSILDYQHEDGFWRTSLLDPDNFPAPESSATALFCYGLAWGINQGVLEKDVYCPALN
RAWSALQTCIHDNGMIGWVQLPAFNPREVKFEHNMDYGAGAYLLAGSEVLNLL

Enzyme Prediction     

No EC number prediction in MGYG000001624_03152.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	350	8.3e-86	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.80e-112	17	353	7	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.30e-74	47	353	28	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATM99759.1	1.87e-277	1	353	1	353
QKD68654.1	4.41e-276	1	353	1	353
QUT00818.1	4.41e-276	1	353	1	353
QKD73828.1	4.41e-276	1	353	1	353
QHP77352.1	4.41e-276	1	353	1	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.30e-81	43	352	48	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	2.73e-52	90	353	114	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.90e-49	90	353	97	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	3.63e-16	136	353	200	414	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	4.38e-81	43	352	53	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	8.75e-81	43	352	55	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	5.29e-66	91	350	136	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	9.39e-11	47	350	30	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001624_03152.