CAZyme Information: MGYG000001624_03272

Basic Information

• Species: Proteus cibarius
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus cibarius
• CAZyme ID: MGYG000001624_03272
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233		26706.33	10.5217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001624	3841359	MAG	China	Asia

• Gene Location: Start: 11057; End: 11758 Strand: -

Full Sequence      

MVLVRKLKKLLIILIALWLLTVVLFSFLPVPFSAVMVQRQISAWSEFDFSYVSHSTWVGE
KEIASVMYLAVIASEDQNFPKHWGFDFDAIEKVFKKNHNNGKTLRGASTISQQTVKNLFL
WDGRSWIRKGLEAGMTPVVELIWSKKRILTVYLNIVEFGDGIFGVEQASQHYFRKPAKQL
TSHEAALLAAVLPNPHIYHVNKPSAYTLKRQQWILNQMRLMGGISFLKKNNLS

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	51	219	3.1e-56	0.9491525423728814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	4.25e-132	21	231	26	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.30e-87	22	223	22	223	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.95e-75	28	225	50	247	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	4.40e-71	51	219	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	4.07e-46	54	226	1	173	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATM98451.1	1.24e-165	1	233	1	233
QPB78392.1	4.14e-164	1	233	1	233
QQP24399.1	4.14e-164	1	233	1	233
QKD72466.1	1.69e-163	1	233	1	233
QUT02400.1	1.69e-163	1	233	1	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.73e-26	70	225	35	190	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	5.37e-26	70	225	35	190	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5FGZ_A	2.82e-21	71	219	172	324	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.84e-21	71	219	193	345	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
4OON_A	7.16e-21	70	224	54	208	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7N087	4.16e-114	7	232	12	237	Biosynthetic peptidoglycan transglycosylase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=mtgA PE=3 SV=1
C6DIR2	2.05e-103	5	233	16	244	Biosynthetic peptidoglycan transglycosylase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=mtgA PE=3 SV=1
Q3V7N8	1.64e-100	5	233	17	245	Biosynthetic peptidoglycan transglycosylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mtgA PE=3 SV=1
A1JR77	2.36e-99	8	232	16	240	Biosynthetic peptidoglycan transglycosylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=mtgA PE=3 SV=1
B1JL77	9.55e-99	15	232	23	240	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997511	0.002472	0.000012	0.000007	0.000006	0.000021

TMHMM  Annotations     

start	end
10	32