CAZyme Information: MGYG000001624_03287

Basic Information

• Species: Proteus cibarius
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus cibarius
• CAZyme ID: MGYG000001624_03287
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203		22214.16	8.1227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001624	3841359	MAG	China	Asia

• Gene Location: Start: 3; End: 614 Strand: +

Full Sequence      

MKKNKLMVFTATLLLSSAGFISTASADVTLKHGYIDVPPSRAFLCSAKGGKLNEDCGPIQ
YEPQSIEGKKGFPNGGPADGQIASGGKDAFSALNEQSADRWHKVAMKSGENTFKWTLTAK
HSTASWQFFITKPEWDVNKPLTRAAFDLTPFCQQDDNGKIPTETVKLNCNIPERSGYQVI
LGVWNIADTGNAFYQVIDADFKK

Enzyme Prediction     

No EC number prediction in MGYG000001624_03287.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	32	199	4.9e-56	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	7.92e-106	1	202	3	194	N-acetylglucosamine-binding protein GbpA.
cd21177	LPMO_AA10	6.13e-80	32	200	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
COG3397	COG3397	1.52e-78	1	201	1	207	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
pfam03067	LPMO_10	4.09e-65	32	198	1	185	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21174	LPMO_auxiliary	2.89e-09	71	198	20	136	lytic polysaccharide monooxygenase auxiliary activity protein. Many proteins in this superfamily are copper-dependent lytic polysaccharide monooxygenases (LPMOs) and include lytic polysaccharide monooxygenase auxiliary activity families 9 (AA9) and 10 (AA10). The substrate-binding surface of this family is a flat beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATM99372.1	1.53e-151	1	203	1	203
QJW52315.1	6.00e-149	1	203	1	203
QUT01438.1	6.00e-149	1	203	1	203
QKD68223.1	6.00e-149	1	203	1	203
QIF92005.1	6.00e-149	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BEM_A	1.68e-73	32	203	1	170	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	3.91e-72	32	203	1	170	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
6T5Z_A	3.97e-68	32	198	1	168	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]
5WSZ_A	7.40e-65	32	200	1	165	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
5L2V_A	1.03e-61	32	200	1	163	Catalyticdomain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S],5L2V_B Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1JQE6	5.98e-60	1	201	1	192	GlcNAc-binding protein A OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=gbpA PE=3 SV=1
Q8GBD4	5.98e-60	1	201	1	192	GlcNAc-binding protein A OS=Yersinia enterocolitica OX=630 GN=gbpA PE=3 SV=1
Q8EHY2	1.31e-57	2	203	3	197	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q8D7V4	1.62e-57	26	201	18	200	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1
Q7MEW9	1.62e-57	26	201	18	200	GlcNAc-binding protein A OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000203	0.999173	0.000171	0.000164	0.000145	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001624_03287.