CAZyme Information: MGYG000001625_00994

Basic Information

• Species: Eikenella corrodens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Eikenella; Eikenella corrodens
• CAZyme ID: MGYG000001625_00994
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000001625_97|CGC1	29342.82	10.6147

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001625	1812730	MAG	China	Asia

• Gene Location: Start: 2536; End: 3306 Strand: +

Full Sequence      

MDTQPTELVSSPIPQPIPAAPPTKKRPGLLRRWFKRLVWSIILFLLGFHLLVFLLLAYWK
GQPVHTSAFMLRHNLSTFSRVQQTWVDDSQIARVVKQAAIASEDAQFSNHDGFDWNGIEH
AMRRNQRSGTIRAGGSTISQQLAKNLFLFAERSYVRKAEEAVITVMMESMWSKERILTVY
LNVAEFGEGIYGIEAAAQHYYHKPASRLRAGEAASLIAMLPNPKYFQQHRNDRRLRNKTR
IILRRMGSADLPPDEE

Enzyme Prediction     

No EC number prediction in MGYG000001625_00994.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	75	246	3.8e-61	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	5.70e-109	30	253	1	230	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	7.51e-90	31	252	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	4.26e-73	75	246	5	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	7.44e-72	26	256	4	250	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.12e-40	90	246	74	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNW08189.1	1.02e-180	1	256	1	256
QED92971.1	3.98e-160	29	256	1	228
AZR60734.1	7.75e-160	30	256	1	227
QMT41558.1	1.57e-129	19	255	10	246
BAV10950.1	8.00e-102	14	255	17	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.02e-29	85	255	22	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.00e-29	85	255	22	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	3.01e-25	75	246	31	202	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	2.85e-23	82	255	155	332	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.87e-23	82	255	176	353	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O24849	4.85e-69	30	252	1	224	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=mtgA PE=3 SV=1
C1D8R6	4.45e-68	32	252	3	228	Biosynthetic peptidoglycan transglycosylase OS=Laribacter hongkongensis (strain HLHK9) OX=557598 GN=mtgA PE=3 SV=1
A3M3C7	3.74e-66	45	252	16	224	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) OX=400667 GN=mtgA PE=3 SV=2
B7GXW9	2.13e-65	35	252	2	224	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain AB307-0294) OX=557600 GN=mtgA PE=3 SV=1
B2HVP6	2.13e-65	35	252	2	224	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain ACICU) OX=405416 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000030	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	59