CAZyme Information: MGYG000001625_01333

Basic Information

• Species: Eikenella corrodens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Eikenella; Eikenella corrodens
• CAZyme ID: MGYG000001625_01333
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522	MGYG000001625_159|CGC1	59322.58	8.5516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001625	1812730	MAG	China	Asia

• Gene Location: Start: 329; End: 1897 Strand: +

Full Sequence      

MTPIPVSITMLVKNAERHLEACLAALAAFDEIIVLDNGSTDRTLDIARRFPNVAVHHHEF
IGFGPMKNLAAGLARNDWVLNIDSDEILPPEQVEAIRVLDWGDSGKIYALPRLNHYRGRP
IKSCGWYPDWVKRLYHRQTVRFNDNQVHESLIEPAGSSVVRLPEKHPLLHYSFDGAAALI
SKMQHYTDLFAAQQQFKRRASVISAVGHGAAAFFKNYILKRGMFDGGDGWTIAFANASGA
YYKYIKLHEANQRLTVSLIITTYNRPDALEAVLRSVLAQRVLPQEVIVADDGSRDDTRAV
VERYRAQFPVPLLHAWQPDDGFRLAESRNRALAQAGSDYIVIIDGDMVLHPEFIADHKHA
AKKGLFVQGSRVILTPEKTNELLANPSSYRVLKWYEKGLEKRFEKRFSACRLPWLSQRIL
RRETRDDFHGIRGCNMAFFREDALKINGFNSDFVGWGREDSEFVARFFNNGGQRANLKFA
AVAYHLYHPEAERAALPENDRLLAAAQEQKLVWCENGVDRFL

Enzyme Prediction     

No EC number prediction in MGYG000001625_01333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	257	371	1.8e-23	0.6764705882352942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06420	GT2_Chondriotin_Pol_N	1.54e-92	258	487	1	182	N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase. Chondroitin polymerase is a two domain, bi-functional protein. The N-terminal domain functions as a GalNAc transferase. The bacterial chondroitin polymerase catalyzes elongation of the chondroitin chain by alternatively transferring the GlcUA and GalNAc moiety from UDP-GlcUA and UDP-GalNAc to the non-reducing ends of the chondroitin chain. The enzyme consists of N-terminal and C-terminal domains in which the two active sites catalyze the addition of GalNAc and GlcUA, respectively. Chondroitin chains range from 40 to over 100 repeating units of the disaccharide. Sulfated chondroitins are involved in the regulation of various biological functions such as central nervous system development, wound repair, infection, growth factor signaling, and morphogenesis, in addition to its conventional structural roles. In Caenorhabditis elegans, chondroitin is an essential factor for the worm to undergo cytokinesis and cell division. Chondroitin is synthesized as proteoglycans, sulfated and secreted to the cell surface or extracellular matrix.
cd02511	Beta4Glucosyltransferase	6.86e-65	5	233	1	229	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
cd00761	Glyco_tranf_GTA_type	4.07e-24	259	363	2	104	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	8.92e-23	257	441	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	5.67e-22	255	488	4	230	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNW09555.1	0.0	1	522	1	522
AZR59327.1	0.0	1	522	1	522
QED91577.1	0.0	1	522	1	522
AUI65361.1	1.92e-275	1	522	1	519
ABR73896.1	9.80e-257	1	518	3	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSK_A	3.37e-06	10	85	72	150	ChainA, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1],7MSK_B Chain B, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
5TZE_C	6.83e-06	257	356	4	103	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	9.23e-06	257	356	4	103	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9XC90	2.63e-47	7	247	6	245	Lipopolysaccharide core biosynthesis glycosyltransferase WaaE OS=Klebsiella pneumoniae OX=573 GN=waaE PE=3 SV=1
P44029	7.12e-41	6	252	4	251	Uncharacterized glycosyltransferase HI_0653 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0653 PE=3 SV=1
Q54435	3.95e-38	7	247	8	247	Lipopolysaccharide core biosynthesis glycosyltransferase KdtX OS=Serratia marcescens OX=615 GN=kdtX PE=3 SV=1
Q7BLV3	1.54e-15	243	501	147	406	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2
Q9CMP0	4.10e-13	243	512	140	410	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001625_01333.