CAZyme Information: MGYG000001625_01705

Basic Information

• Species: Eikenella corrodens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Eikenella; Eikenella corrodens
• CAZyme ID: MGYG000001625_01705
• CAZy Family: GH102
• CAZyme Description: Membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		46985.38	10.1084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001625	1812730	MAG	China	Asia

• Gene Location: Start: 672; End: 1979 Strand: +

Full Sequence      

MAGKFLSSRNGWLLLSALLLGGCFFHSRPKPSGGGVGAMPALPPGQRYAEGYQHRVSGSP
AGYKAVSFAALPQWPQQDFAASLNAFRKSCTALKNKLQWQNVCAQADRVGSQSAAARQFF
EQYFTPWEVSHNGQLGGTITGYYEPVLHGSARQTSQARFPIYGLPADLVTVPLAGAPQSG
TVRIQLTGRNSGQIAANGEYMANLADFPGREKSRSLKGRVSGSRFVPYYTRAQINAGAVN
GSAPVLAYADDPVELFFLHIQGSGRIRTPDGRYIRLGFADKNDHPYISIGRYMANKGYLP
LAQTSMPKIRDWLRAHPDKLAEVLGQNPSYVFFRQLPDGNDGPIGSLGVPLSGGYSGAVD
KRFITLGAPLFLATAHPETGHALNRLIMAQDTGSAINGAVRVDFFWGYGDEAGRVAGRMK
QTGYVWLLLPNGMLP

Enzyme Prediction     

EC	4.2.2.N1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	147	334	1.9e-58	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2821	MltA	2.24e-125	70	433	34	368	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
pfam03562	MltA	9.33e-109	74	334	1	231	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	1.06e-73	147	334	1	157	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	1.07e-68	146	334	1	153	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	9.47e-45	134	428	106	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNW09325.1	0.0	1	435	1	435
AZR60513.1	1.15e-317	1	435	5	439
QED92511.1	3.46e-317	1	435	5	439
QMT40271.1	3.67e-241	1	435	1	433
ASP17988.1	3.23e-196	7	435	5	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2G5D_A	6.32e-176	56	435	35	418	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
2G6G_A	6.45e-171	56	435	35	418	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]
7ESJ_A	5.02e-88	61	433	22	362	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
6QK4_B	7.04e-80	66	431	28	347	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
3CZB_A	5.58e-52	65	431	9	342	Crystalstructure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15],3CZB_B Crystal structure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	1.69e-25	78	428	58	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	1.69e-25	78	428	58	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
Q9KPQ4	2.58e-23	230	428	147	349	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
Q8K9A7	2.47e-19	245	428	177	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000426	0.000142	0.999152	0.000001	0.000311	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001625_01705.