CAZyme Information: MGYG000001626_01465

Basic Information

• Species: Phascolarctobacterium sp900544795
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium; Phascolarctobacterium sp900544795
• CAZyme ID: MGYG000001626_01465
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282		32293.81	6.8309

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001626	2152939	MAG	China	Asia

• Gene Location: Start: 95125; End: 95973 Strand: +

Full Sequence      

MTEFWEKNKKRLAAVVAFIAAVLLCLGFYVRSDYQSYCREAVPILEYHGIGAADGWPQDL
FVSSATFENHLKYLHDNGYKMVAVEEMAAMFNKGESTEKVVALTFDDGYLDNYTNVLPLL
QKYHATATFFIVHSKIGHYRYMTHDQIQALIAAGMELGSHTINHQILTDIKPEFLTWELA
TSRYFFKKDFDGYVVRSLSYPNGKYDPEILAASKKYGYYWAVTGNAGAVTKNTLEQEPLE
LGRIYINDEDGGIKTFRERLRYSYWVGYLKARGINIHFLSGL

Enzyme Prediction     

No EC number prediction in MGYG000001626_01465.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	93	219	2.2e-33	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	6.12e-50	101	248	2	156	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
pfam01522	Polysacc_deac_1	1.87e-34	93	218	1	121	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10969	CE4_Ecf1_like_5s	2.65e-33	64	262	1	216	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
COG0726	CDA1	7.50e-29	47	227	11	193	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10967	CE4_GLA_like_6s	6.80e-28	99	216	1	116	Putative catalytic NodB homology domain of gellan lyase and similar proteins. This family is represented by the extracellular polysaccharide-degrading enzyme, gellan lyase (gellanase, EC 4.2.2.-), from Bacillus sp. The enzyme acts on gellan exolytically and releases a tetrasaccharide of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the nonreducing terminus. The family also includes many uncharacterized prokaryotic polysaccharide deacetylases, which show high sequence similarity to Bacillus sp. gellan lyase. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY32711.1	1.91e-32	42	232	65	251
ABO51554.1	1.25e-26	9	262	8	279
AFQ42959.1	1.85e-26	40	263	63	280
AFC84974.1	1.20e-25	42	227	6	204
AQS60291.1	1.21e-25	8	262	2	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	3.68e-22	42	246	9	215	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
6GO1_A	1.54e-16	39	239	97	298	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]
4V33_A	4.05e-16	39	247	141	347	Crystalstructure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis],4V33_B Crystal structure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis]
2J13_A	1.63e-10	91	219	47	172	Structureof a family 4 carbohydrate esterase from Bacillus anthracis [Bacillus anthracis str. Ames]
4U10_A	2.42e-09	62	199	29	189	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	3.07e-36	42	232	65	251	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q81AF4	4.91e-11	96	218	19	136	Peptidoglycan-N-acetylglucosamine deacetylase BC_3618 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=BC_3618 PE=1 SV=1
Q04729	3.11e-10	91	222	59	190	Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus OX=1422 PE=3 SV=1
Q6TYB1	9.35e-10	39	230	53	257	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis OX=1282 GN=icaB PE=1 SV=2
Q5HKP8	9.35e-10	39	230	53	257	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000018	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	30