CAZyme Information: MGYG000001626_02121

Basic Information

• Species: Phascolarctobacterium sp900544795
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium; Phascolarctobacterium sp900544795
• CAZyme ID: MGYG000001626_02121
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	MGYG000001626_23|CGC1	59290.59	9.0429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001626	2152939	MAG	China	Asia

• Gene Location: Start: 17625; End: 19175 Strand: +

Full Sequence      

MKRIEKGSLLVLAIIVAFNIFFGLGSIPLLDPDEPVYAETAREMIQFNDYLSPRIYNEYW
FDKPPMYYWLVAGAMHVFGDGEFAARFPAAMMAFLTVMMLYCSVTKLFSEWAGFWSALVL
ATSCQFFYLGKAAVTDTTLLFFLTGALLAYIHKKYWLMYICMALATVTKGPIGLVLPGAI
IFLHIACTGQWRRILEMHCLRGMVLYLLVAGPWYYLMYQVHGMEFIDTFLGFHNITRFTT
PEHPSRVLWWYYFPVIVLGLFPWTGLLLQSIKSAFADCRSEEMQKMIFVQIWWLFVFIFF
SISKTKLVSYILPMFPALAIMIGWNIARMQKENYGVRWSWVLGTGIMFLVLTAGWVIGGQ
QLPEVAFGGIVLGVVTFILGVSIIWALVVYRDINFAAWLHVITGVLTMVIAFSFLLPMVA
NRFSVKEIVKVYQSKCDQKKPVYVDKFLHPGFMYYSGVPGTEVKPKTTDLTQALNDPQQK
YVLVRGLELRRLKNQDQVQNLREVKVIGDIYLLEKY

Enzyme Prediction     

No EC number prediction in MGYG000001626_02121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	500	1.4e-121	0.9481481481481482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	8.20e-64	1	431	2	446	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.08e-37	1	417	2	429	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.13e-20	62	215	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.65e-05	11	176	2	189	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	0.004	62	186	86	222	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77242.1	1.05e-239	1	515	1	518
AOH48432.1	2.25e-172	2	505	5	515
QNH53437.1	1.82e-171	2	495	5	505
AKT54119.1	2.20e-167	2	491	5	501
AME03144.1	2.20e-167	2	491	5	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	8.18e-35	11	335	35	373	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	1.46e-34	6	351	2	327	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
O67270	9.56e-32	5	321	3	316	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
C5BDQ8	2.48e-30	29	398	27	411	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B4EUL1	2.70e-29	5	332	7	339	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
Q7N3Q9	3.78e-29	29	321	31	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000007	0.000002	0.000000	0.000000	0.000004

TMHMM  Annotations     

start	end
7	29
83	105
126	148
163	185
198	220
247	269
286	303
307	326
338	357
367	389
396	418