CAZyme Information: MGYG000001627_01411

Basic Information

• Species: Gemmiger sp900539695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900539695
• CAZyme ID: MGYG000001627_01411
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612	MGYG000001627_17|CGC1	68434.15	6.6684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001627	2528284	MAG	China	Asia

• Gene Location: Start: 6023; End: 7861 Strand: +

Full Sequence      

MSLETKRIKELFGYARTLTKEQGVGVMAARAAGFFKRRFFGKKARYLPAKQTLDTQRADA
GQNAKNWPAISILTPLYNTPPQFLQQFLDSVQGQTSPNWQLVLVDASDAAHTDVERTVQA
RAASDPRIVYRKIENKGIAANTNEAAKLATGTYLALADHDDMLAPHAVYCMGKLLAETGA
DFAYSDEALFEKTPEHPRVGHFKPDYAPEYLMAVNYICHLAVFKKELFDAVGGERPACDG
AQDHDLFLRLIDEMQRRDPAAKPVHVPQVLYYWRVHAASTSGGTGAKPYVEAAARKAVAD
HLAATGRHGTVEPGKFPGTCHVVWDLPDPEPLVSILIPNKDHTDDLEKCLHSIYAKTTYE
NFEVIVIENNSTDPATFDYYKRIPERYDNARVVMYRGGFNFSRINNFGRKYAAGKYLLLL
NNDIEVIGGDWLTQMAGECAQPGVGICGAMLYYPDDTIQHAGIITGLGGYAGHSHKYHKR
GGSGYMFRLATVQDFSAVTAACLLVRTAVYDSVHGLDEEFTVAYNDVDFCLRVRDAGWRI
VWTPYAELYHHESKSRGSDENDPAKKARFDAEHDRLYAVHGKENILHDPYYSPSLSLDYE
DFRESGDLRHLK

Enzyme Prediction     

No EC number prediction in MGYG000001627_01411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	71	184	7.2e-17	0.6588235294117647
GT2	333	553	6.6e-16	0.9130434782608695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	5.55e-76	68	275	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	5.56e-42	335	552	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.55e-31	330	558	2	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.39e-18	71	281	1	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	2.01e-16	72	254	1	150	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27819.1	7.37e-303	1	612	1	615
CBL01588.1	2.11e-302	1	612	1	615
ATL90529.1	2.31e-300	1	612	1	615
QIA43913.1	1.54e-298	1	612	1	615
ATP00360.1	1.54e-298	1	612	1	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	4.91e-07	332	423	6	94	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.05e-125	50	602	348	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.69e-76	68	601	319	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P46370	3.63e-09	333	550	132	329	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1
Q58457	1.43e-07	68	251	8	195	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P9WMY2	2.16e-07	326	559	1	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001627_01411.