CAZyme Information: MGYG000001629_00918

Basic Information

• Species: Phascolarctobacterium_A sp900552005
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900552005
• CAZyme ID: MGYG000001629_00918
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533		60842.07	9.4114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001629	1573595	MAG	China	Asia

• Gene Location: Start: 13806; End: 15407 Strand: +

Full Sequence      

MQKKYWLLFWLGAAALLFFSNGSLQITDSVESNYALTAKEMVLSGDWISPQIYGHYWYDK
PVMFYWLTALAFKIFGFTEFAARLFPSIFGLAGLGLVCWGGSKLYGSRSGFYSGIVLLTC
MEFFLISKSVITDAVLFLFFSGTLLFFYLGYQEGRKSYWYIMYACAALSTLTKGPVGFLL
PGLIITLFLLWQKDWRVLMRMCLPTGIAVFLLIALPWYGAMCYLHGAEFINTFFGTHNFL
RATVSEHPRDNVIYYYTAVNLLAFFPWSLLLPVIIYRKYKQGNLCLKQQEKFLLLWMSVV
FIFFQCMATKYITYTYPILFPGALLLGNYLEQQEEVLSNKVFLTLMLGLFFGLTITAFWA
AKTGLVTGKMMFLLPFSLIFGLLLHFALQYYGKRIIYSISIMSVAFYLALIGCIAVPFSQ
QRSAKDLGLMLPQITEEESIGVYGNYPTSAVFYSGKRIVKLMPAKEIVGFSPQAYSWSSK
NVMPYAAVEQENYPFVIVGRKRLQNFQKISPVAWSRKVTLDDWIILQTADKAG

Enzyme Prediction     

No EC number prediction in MGYG000001629_00918.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	459	2e-107	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.28e-49	1	424	6	435	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.93e-29	1	354	2	358	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.14e-20	59	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.22e-06	31	220	32	233	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	3.66e-218	1	527	1	525
AEQ23377.1	3.89e-153	1	526	1	541
ADB46704.1	1.47e-150	1	526	1	542
AXL22207.1	3.24e-120	11	527	37	519
AJQ28749.1	5.36e-114	3	484	15	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.21e-30	6	332	33	366	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	1.04e-24	31	327	30	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
O67270	8.50e-23	1	460	1	441	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8GDR9	2.73e-22	31	342	34	346	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1
O67601	4.58e-22	19	350	18	331	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
Q02R27	3.59e-21	20	341	23	341	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.559019	0.429748	0.008710	0.000620	0.000588	0.001319

TMHMM  Annotations     

start	end
5	27
62	77
84	106
110	127
134	151
171	190
197	219
253	275
292	309
313	330
342	361
371	388
395	417