CAZyme Information: MGYG000001630_00375

Basic Information

• Species: Prevotellamassilia sp900542795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900542795
• CAZyme ID: MGYG000001630_00375
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		45593.41	9.076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001630	2503993	MAG	China	Asia

• Gene Location: Start: 38759; End: 40000 Strand: -

Full Sequence      

MKKIILALATLTLFTACHKRKVEGSTADNGAFAKVAKRNANDNVGRISESGELIIGTISG
PDTYFDYQGRGMGLQYALAENFAQSLGVGVRVELATDSTELVKKLKAGEIDVIAYQLSET
YCKKQGIAVAGAHNNAGTQSWATLAQASDLVQALDDWYGDGVEIKAQKLEADWLKNRTIV
HRKVRAPFISREKGIISTYDNYFKQAATRTGWDWRLIAAQCYQESGFDPNATSWAGACGL
MQLMPSTAAQFGLSQQKVFSPAENVATAASVINHLQRQFANIPDAAERIKFVLASYNGGI
GHIRDAQALARKHGGNPQRWDDVSYYVRNLSSAQYYRDPVVKCGYMIGSETYGYVLSIMD
RWRQYGGDVSRMSSGNMGQATEQIKDGVRNTPHKRNRYSKQHEILSPEEMSNI

Enzyme Prediction     

No EC number prediction in MGYG000001630_00375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	206	362	1.4e-25	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	4.23e-75	203	365	1	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	9.97e-48	1	365	10	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	9.01e-39	47	369	19	431	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	1.26e-22	199	337	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.27e-21	203	312	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	4.41e-105	8	380	39	409
ALO48082.1	1.90e-104	3	383	4	381
QUB48180.1	5.54e-104	8	385	10	389
AGB28026.1	1.24e-99	24	367	53	387
BCS86517.1	1.71e-99	15	367	8	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.90e-20	199	358	259	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.99e-20	199	358	266	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	1.99e-20	199	358	266	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	2.20e-20	199	358	252	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.20e-20	199	358	252	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.05e-25	204	359	291	442	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A4SNZ5	2.75e-25	97	365	186	449	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
A0KJ50	6.86e-25	46	365	42	449	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
Q30PQ0	1.38e-24	100	360	190	450	Membrane-bound lytic murein transglycosylase F OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) OX=326298 GN=mltF PE=3 SV=2
B0TLJ6	2.00e-24	47	358	30	433	Membrane-bound lytic murein transglycosylase F OS=Shewanella halifaxensis (strain HAW-EB4) OX=458817 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001630_00375.