CAZyme Information: MGYG000001630_00456

Basic Information

• Species: Prevotellamassilia sp900542795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900542795
• CAZyme ID: MGYG000001630_00456
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		37065.62	10.2447

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001630	2503993	MAG	China	Asia

• Gene Location: Start: 9620; End: 10576 Strand: +

Full Sequence      

MCNFAINHPIEHFKMKIRRFLWLVVAVVCMLPLGAQTAYHQYINQYAPMAQDQMKRYGIP
ASITLAQGLLESGAGKSKLAREARNHFGIKVGMNWTGPYMIMADDRPDDKFRVYHTVSDS
YEDHSAFLRNGKRYASLFDLSPTDYKGWAHGLKRAGYATNPSYAQSLINIIERYNLHDYD
KKRHHRRDDKIEHKAKIEYQNFADGRPIRRCNGQYYVIAREGDTYASVARLVKQKEEKLR
KYNDVDVKRALTPGDVVYLGKKRRKADPTMKRRYHVMEAGESLYSISQRFGIRLKSLCKM
NPISRNYHFKVGDEIRIK

Enzyme Prediction     

No EC number prediction in MGYG000001630_00456.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	47	176	1.6e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	6.78e-42	40	192	44	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	8.90e-40	41	180	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	2.20e-29	42	176	11	141	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	3.56e-27	47	176	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12709	flgJ	3.12e-24	42	173	176	318	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ11765.1	1.03e-96	13	318	2	323
QNT66218.1	3.17e-89	25	318	11	307
ADE83099.1	1.12e-88	38	318	25	303
QVJ81211.1	1.12e-88	38	318	25	303
QJR97929.1	7.07e-87	23	317	12	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	5.16e-17	42	171	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.32e-17	42	171	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	4.38e-16	42	171	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	4.16e-12	25	180	20	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	8.32e-10	41	183	62	215	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	9.08e-19	42	180	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P75942	2.19e-14	42	172	152	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	2.19e-14	42	172	152	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9KQ15	4.83e-14	40	177	162	312	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	9.50e-14	41	170	241	381	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.608832	0.384296	0.003729	0.000496	0.000468	0.002164

TMHMM  Annotations     

start	end
20	39