CAZyme Information: MGYG000001630_00737

Basic Information

• Species: Prevotellamassilia sp900542795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900542795
• CAZyme ID: MGYG000001630_00737
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1295		146789	6.4492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001630	2503993	MAG	China	Asia

• Gene Location: Start: 40481; End: 44368 Strand: +

Full Sequence      

MKPQLDFILLYTPQNEGVITSLKTAESINHVFLLTSEAHASEAEKHVSEKCSIILTDAPQ
SSKCIRQIAQKASAPYTFFYLSGHSLSLGYRALERMIQVANDADRQTNALMLYTDRYDDK
GQHPTIDYQEGALRDDFDFGSLLLFRTQGLKDFAKSECCGRFTHAALYALRLYTSANGHI
AHLREPLYTEQETDLRASGQKQFDYVNPNNREVQIEMERACTEHLKRIGAWLAPDEYDEL
PDNKENYPVEASVIIPVRNRVRTIKDAIGSVLEQEAKFKFNVIIVDNHSTDGTAEAVQAF
SNDERVVLIQPSRTDLGIGGCWDVAIRSAQCGRYAVQLDSDDLYSSPQTLQRIVDAFRQQ
HAAMVIGSYRMVNFDLETLPPGLINHAEWTTANGRNNALRINGLGAPRAFRTDILRTIGF
PNTSYGEDYALGLVFSRHFRIARIFDELYLCRRWDGNSDAALSIEKQNKNNLYKDLIRTL
ELRARRAMIAHWNHPLNQTEVDAFISKQLETWQEARERFEALQTQVMTRELPLEDMELRV
QFNPSRIVSTGAKVDKATLKKRPCFLCDNHRPASQQQLPVMGKIQLLVNPFPILPKHLTL
PTRRHTAQRFSHFAPIMDSIAWQLPGMFVFYNGARCGASAPDHAHLQAGQRGFVPIEKDW
KYYENRLQRIYPSTKDEEADLEEQGYDPKTGGIFMLRGYACPAFVIQGPACKQSPILFNK
LMEVLPIADKQPEPDINILSWRQEGGPSAPDHIVSVIFVRKKHRPDCYHAEGKNQLLISP
GAIDMGGLIITPRETDYKRLTPHTAANILREVTINENEMSAIARKLHSRTHTHNTHKPTD
GESVKNENALLKSLQDRDICVGIMHTEKVSFKLNGTFTAKGETVTNQQEACCTEGGIAWN
GNIYSELTFIPEDENTCSFTLQNVTIGIGFHWQRQEDQTFKGRLRLIVDEEKLVVINELP
VEEYLESVISSEMNANSSLGLLKTHAVVSRSWVYSQMLNRLQGEGRPGDFFNFVHRPGES
VRWHDRSDHTLYDVCADDHCQRYQGITRATLPQVHEAVISTAGEVLMYDGKLCDTRFSKS
CGGISERYSSCWGNEDFAYLQPVRCDADNNEPLPDLTNEAEAARWIRTTPKAFCNTTNKA
LLAQVLNSYDQETPDFYRWRVELTQEKVRQLVEERTEQKLGEIIDLQPVERGASGRLIRL
RIVGTEGELIVGKELEIRRLLSDSHLYSSAFIIERNEVDAQTHIPQSFTLIGAGWGHGVG
LCQIGAAVMADKGYAYNDILKHYYQGADIFKLFGK

Enzyme Prediction     

No EC number prediction in MGYG000001630_00737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	252	382	1e-19	0.7529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	2.10e-92	612	819	1	187	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
TIGR02669	SpoIID_LytB	7.07e-48	955	1289	2	265	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG2385	SpoIID	4.50e-37	894	1289	89	390	Peptidoglycan hydrolase (amidase) enhancer domain [Cell wall/membrane/envelope biogenesis].
TIGR02870	spore_II_D	2.17e-35	947	1289	63	335	stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination]
400675	pfam08486	6.74e-25	950	1067	2	100	SpoIID Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ11638.1	0.0	62	1293	44	1261
QNT65264.1	0.0	1	1293	1	1259
BCS84357.1	0.0	16	1293	18	1252
QVJ80566.1	0.0	18	1293	20	1223
QUB57862.1	0.0	2	1289	4	1244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RWR_A	1.15e-13	944	1289	51	317	2.1Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis],4RWR_B 2.1 Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis]
5I1T_A	2.75e-07	958	1289	63	326	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
5TXU_A	3.09e-07	958	1289	87	350	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
5TZE_C	7.61e-07	252	373	4	124	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	1.14e-06	252	373	4	124	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13251	2.30e-12	956	1289	73	330	Stage II sporulation protein D OS=Bacillus amyloliquefaciens OX=1390 GN=spoIID PE=4 SV=1
P07372	4.12e-11	956	1289	72	329	Stage II sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIID PE=4 SV=1
C0QYX7	1.57e-10	940	1289	88	351	Uncharacterized protein BHWA1_00569 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) OX=565034 GN=BHWA1_00569 PE=1 SV=1
A0A0H3JPC6	6.23e-06	252	373	5	125	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=tarS PE=1 SV=1
A0A0H3JVA1	6.23e-06	252	373	5	125	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain MW2) OX=196620 GN=tarS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001630_00737.