CAZyme Information: MGYG000001630_00879

Basic Information

• Species: Prevotellamassilia sp900542795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900542795
• CAZyme ID: MGYG000001630_00879
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554	MGYG000001630_18|CGC1	61567.74	8.1725

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001630	2503993	MAG	China	Asia

• Gene Location: Start: 21850; End: 23514 Strand: +

Full Sequence      

MKMVKCFAFAFAALLTLGSSLAQAQSLSPSTKWHWNKGSIDIETPARPAGQKDVLGLKLP
KIKKVRIGLVGLGMRGPGAVENFCVIPGVEIVALCDYVPERAEACQQYLRKAGLAPAAIY
SGENGYKQLCARPDIDLVYVATDWEHHFPVAECALQHGKNVADEVPSAMNLEECWKLVNL
SEKMQKNCMILENCCYDWFEMRTLNMAQHGVFGEIIRAQGAYIHNLDDFWDYYWKNPNGS
DPEKLGWRLKYNRENRGDVYATHGLGPVAQALDIHRGDRMKTLVAMDTKSVHGKELVEKK
TGKPCNDFRNGDHTTTLIRTENAKVIELQHDVMNPQPYSRLYQLTGTKGFANKYPVEGYA
VDSKQLAASGHKPKVDNLSSHSFMPEAEKQALEKQYESPILAKFGELAKKVGGHGGMDFI
MCARLIYCLQHGLPLDMDVYDLAEWCCIAELGAISMDNNCASVSFPDFTRGMWNKVKGYK
HAYATPAEEAAVEAYSNKVTAIQKEAAAKFNLWSLYDAVKAAKTDADKAKAQKAYDKAFA
KAKAKVAKAEKAIK

Enzyme Prediction     

No EC number prediction in MGYG000001630_00879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	61	475	1.2e-152	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	5.48e-19	63	362	2	268	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.67e-13	65	190	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	6.69e-04	63	172	16	135	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
PRK11579	PRK11579	0.001	64	183	4	113	putative oxidoreductase; Provisional
PRK10206	PRK10206	0.004	133	233	63	155	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13386.1	2.64e-295	1	521	1	520
QCQ31109.1	1.52e-284	6	509	13	509
ALJ58162.1	2.27e-276	13	505	30	520
QUT75090.1	1.66e-275	7	509	11	507
QRO24012.1	1.79e-275	15	509	7	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	7.44e-83	47	473	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.05e-67	63	477	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3EC7_A	1.41e-08	65	224	24	178	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3EVN_A	1.59e-06	62	227	3	161	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
4KOA_A	5.03e-06	65	178	2	107	CrystalStructure Analysis of 1,5-anhydro-D-fructose reductase from Sinorhizobium meliloti [Sinorhizobium meliloti 1021]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	3.67e-270	24	509	27	509	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	2.11e-268	31	509	33	508	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	1.32e-253	14	548	11	542	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6KX96	2.30e-201	40	484	36	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	3.27e-200	13	484	13	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000357	0.998907	0.000185	0.000202	0.000176	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001630_00879.