CAZyme Information: MGYG000001630_00899

Basic Information

• Species: Prevotellamassilia sp900542795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900542795
• CAZyme ID: MGYG000001630_00899
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MGYG000001630_19|CGC1	33026.11	8.6316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001630	2503993	MAG	China	Asia

• Gene Location: Start: 13834; End: 14679 Strand: -

Full Sequence      

MRLIKMTGGLGNQMFIYALYISMKQRGLNACIDLSDMMHYHVHHGYEMHRVFGLPRTELI
LNQGLKKVIEFLFFKTILERKQGGRLEPFFGKHHWPLIYYKGFYQNERYFADCKDEVRRL
FTFNMAEANELSVQMAAQIEYEPCAVSLHVRRGDYLLPKHFKNSGCVCTRNYYRRAVAEV
LKRMPNARFYVFSDGMDWVKENLDLPANTVYVTHNTGSDSWQDMMLMSHCRHNVICNSTF
SWWGAWLNAHSDKQVFCPDHWTANDPASVVVPKEWVQISVK

Enzyme Prediction     

No EC number prediction in MGYG000001630_00899.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	3	278	1.5e-68	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.00e-63	6	261	7	255	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.33e-30	8	248	8	266	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	8.06e-04	3	243	3	276	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	0.003	116	243	44	196	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49131.1	4.62e-120	1	280	1	280
QUT44870.1	4.62e-120	1	280	1	280
QQY37044.1	2.17e-118	1	280	1	280
QUT58051.1	2.17e-118	1	280	1	280
ABR40839.1	2.17e-118	1	280	1	280

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	7.52e-25	6	278	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
P19526	2.21e-13	96	247	160	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=FUT1 PE=1 SV=1
Q9TUD6	2.22e-13	96	247	161	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Pan troglodytes OX=9598 GN=FUT1 PE=3 SV=1
Q9TUD4	2.22e-13	96	247	161	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=FUT1 PE=3 SV=1
Q866E6	7.45e-13	96	247	161	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Aotus azarae OX=30591 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001630_00899.