CAZyme Information: MGYG000001630_00909

Basic Information

• Species: Prevotellamassilia sp900542795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900542795
• CAZyme ID: MGYG000001630_00909
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000001630_19|CGC2	42555.58	8.646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001630	2503993	MAG	China	Asia

• Gene Location: Start: 25255; End: 26400 Strand: -

Full Sequence      

MKIFLIAGEASGDLHAAHLMRAIKQLQPDVEFRFYGGDEMQAVGGTLLCHYRELAYMGFV
QVALHLRTILRGMAQCKREIAEWKPDALILVDYPGFNLKMARFAKENAICPVFYYISPKI
WAWKEHRIHAIRRDVDRLFSILPFEVDFFEGKHHYPISYVGNPSVDEVSAFIAAQGAPKS
DGQTIALLPGSRRQEIVDNLSRMLQAALPFATNYKLVIAKAPAIESDFYERIIQASGIDA
SRVQMVSGQTYALLSHATAALVTSGTATLETALFRVPQVVCYYIRCGWFVSRVRPYFLKV
PFISLVNLIAGREVVPELVADGMCVENVRAHLAQLLPADAPARLAQLKGYEEMAKRLGKP
GAPERAAAEMVKWIETNKPIS

Enzyme Prediction     

No EC number prediction in MGYG000001630_00909.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	357	8e-110	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.92e-109	1	379	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.52e-101	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.96e-72	3	319	1	322	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.58e-66	3	368	8	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.98e-45	1	327	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77942.1	5.86e-153	1	375	1	377
QRO23865.1	6.90e-147	1	378	1	378
ADE83537.1	2.90e-146	1	367	1	358
QCQ31581.1	7.69e-146	1	375	1	376
QDH54418.1	7.96e-146	1	375	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.74e-43	1	375	7	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.74e-43	1	375	7	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	3.27e-68	2	374	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	2.81e-66	3	375	6	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B8JE78	3.71e-63	2	371	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	5.22e-63	2	371	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q74AT9	2.96e-62	2	374	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001630_00909.