CAZyme Information: MGYG000001631_00030

Basic Information

• Species: Bilophila sp900553145
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp900553145
• CAZyme ID: MGYG000001631_00030
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	MGYG000001631_1|CGC1	38089.27	10.0515

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001631	3785752	MAG	China	Asia

• Gene Location: Start: 35801; End: 36823 Strand: +

Full Sequence      

MTTSSFHAASAPIEWVVIRLSALGDVALTTGVLEYWHRTHGWTFTVITREAFVPVLEGHP
AVRAVVGLTKEELRFPRLLGVFRDLAEAHAGKGLLDLHGTLRTRLLSLLWQGPVRRYRKL
GLERRLFLRSKGRLFRDKLRLWNVPQRYALAVEPTPPPRSALLPHIWLSDEEIGQGRRLL
EPLPDKAGIPPIALHPYATHPDKAWNEVYWRQLMEMFEARGIPWIVIGRGTGIEGIPASR
DFTNRTSLRETCALLRASSVLITGDSGPMHLAGAVGTPVLALFGPTTEEWGFFPAGPKDR
VLEAKLDCRPCTLHGKKHCDRNHACMRAITPEWVMSALDG

Enzyme Prediction     

No EC number prediction in MGYG000001631_00030.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	94	326	3.1e-45	0.9244444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	5.48e-45	17	339	4	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.60e-34	17	340	6	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02195	heptsyl_trn_II	3.47e-17	137	340	123	331	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	8.56e-16	187	311	103	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02201	heptsyl_trn_III	1.34e-08	177	286	171	289	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS96432.1	6.49e-140	14	340	7	331
ADP86511.1	6.95e-140	14	340	9	333
ABM28232.1	3.04e-138	14	340	7	331
AGC49436.1	3.44e-117	14	338	17	340
CAJ54092.1	3.44e-117	14	338	17	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	2.93e-06	16	286	4	282	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	2.93e-06	16	286	4	282	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	3.00e-06	16	286	4	282	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	9.58e-06	201	290	193	294	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001631_00030.