CAZyme Information: MGYG000001631_02909

Basic Information

• Species: Bilophila sp900553145
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp900553145
• CAZyme ID: MGYG000001631_02909
• CAZy Family: GH133
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268		29751.6	4.6321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001631	3785752	MAG	China	Asia

• Gene Location: Start: 3869; End: 4675 Strand: -

Full Sequence      

MTPDAEGFLSVGDAGTQLTWMDAVADGRPVTDLHGQPVEISALWYNALAFADNLAKTFGE
PEWRRTERLAAMRSVFLKRYWVTDERGDYLADVWRDGEVEAWVRPNQLFALSLPYPVLEE
DFYANVLSRVRRCLLTPYGLRTLAPSAPGYRPLYEGGPAERDGAYHQGTVWPWLLGAYGE
AVLRAAWDVPGSARELLRTIRPLFAQHLGDAGIGSVSEIFDGDPPHLPNGCIAQAWSVAE
CLRLLYLLKEAAPGVYAEWEADARKGGN

Enzyme Prediction     

No EC number prediction in MGYG000001631_02909.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH133	4	243	9e-66	0.6451612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	4.95e-82	7	243	135	374	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	1.19e-51	6	246	381	604	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
TIGR01561	gde_arch	2.62e-39	15	183	403	575	glycogen debranching enzyme, archaeal type, putative. The seed for this model is composed of two uncharacterized archaeal proteins from Methanosarcina acetivorans and Sulfolobus solfataricus. Trusted cutoff is set so that essentially only archaeal members hit the model. The notable exceptions to archaeal membership are the Gram positive Clostridium perfringens which scores much better than some other archaea and the Cyanobacterium Nostoc sp. which scores just above the trusted cutoff. Noise cutoff is set to exclude the characterized eukaryotic glycogen debranching enzyme in S. cerevisiae. These cutoffs leave the prokaryotes Porphyromonas gingivalis and Deinococcus radiodurans below trusted but above noise. Multiple alignments including these last two species exhibit sequence divergence which may suggest a subtly different function for these prokaryotic proteins. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
TIGR01531	glyc_debranch	2.05e-18	19	248	1197	1464	glycogen debranching enzymye. glycogen debranching enzyme possesses two different catalytic activities; oligo-1,4-->1,4-glucantransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). Site directed mutagenesis studies in S. cerevisiae indicate that the transferase and glucosidase activities are independent and located in different regions of the polypeptide chain. Proteins in this model belong to the larger alpha-amylase family. The model covers eukaryotic proteins with a seed composed of human, nematode and yeast sequences. Yeast seed sequence is well characterized. The model is quite rigorous; either query sequence yields large bit score or it fails to hit the model altogether. There doesn't appear to be any middle ground. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SFV72707.1	1.34e-131	4	266	417	680
AMD88862.1	1.00e-112	4	260	411	666
VZH34337.1	1.25e-108	4	260	416	671
ATD82029.1	4.26e-108	4	259	415	669
SPD34779.1	4.26e-108	4	259	415	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D06_A	3.44e-10	19	246	1238	1520	CrystalStructure of the Candida Glabrata Glycogen Debranching Enzyme [[Candida] glabrata CBS 138],5D06_B Crystal Structure of the Candida Glabrata Glycogen Debranching Enzyme [[Candida] glabrata CBS 138]
5D0F_A	3.44e-10	19	246	1238	1520	CrystalStructure of the Candida Glabrata Glycogen Debranching Enzyme (E564Q) in complex with maltopentaose [[Candida] glabrata CBS 138],5D0F_B Crystal Structure of the Candida Glabrata Glycogen Debranching Enzyme (E564Q) in complex with maltopentaose [[Candida] glabrata CBS 138]
7EIM_A	3.44e-10	19	246	1238	1520	ChainA, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EIM_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJP_A Chain A, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJP_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJT_A Chain A, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJT_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138]
7EKU_A	3.44e-10	19	246	1238	1520	ChainA, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EKU_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138]
7EKW_A	3.44e-10	19	246	1238	1520	ChainA, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EKW_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q06625	1.40e-09	19	251	1246	1531	Glycogen debranching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDB1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001631_02909.