CAZyme Information: MGYG000001633_00245

Basic Information

• Species: RC9 sp000435075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000435075
• CAZyme ID: MGYG000001633_00245
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000001633_2|CGC2	44698.94	5.3135

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001633	2721018	MAG	China	Asia

• Gene Location: Start: 91088; End: 92287 Strand: +

Full Sequence      

MISAAAVCISAISCSKDVEEWNGNGGSKPKPEIVIDWKSRAKETYLSIVRNYRIGTGAAS
GLFKENYPAGSGDGLASFLWPYDGMVSGLAALNRLGEDVGYVNAVENFQKYYRAYGAVAV
GGYGSSTDGTNGGGDRFYDDNSIVGIELVEAYRQTKDTKYLDRCAQIVKFLYSGRDDTFG
GALWWNESYRNVPGNDSSNKPACANGFATWFLLSYYEFCPQSEKKQVLDMAKEFYGWLYE
NLRDPMDNVYWNSKGADGVINKTKWTYNSGAMIASGLRLYKITGEAKYLQQAKDTADGAY
KNFVRNNNDLFCYPTHDPWFTVQLIKSYIELEPEHTPCKSYIKTFVSYADYAWKHARGQN
GLFYEDWSGRNPNLDRDKSLLMQAAALESFAIIALYTGE

Enzyme Prediction     

No EC number prediction in MGYG000001633_00245.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	62	384	1.7e-51	0.88268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	7.53e-15	130	311	78	263	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	2.60e-06	131	296	82	241	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
cd04792	LanM-like	0.001	148	312	601	755	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
pfam03663	Glyco_hydro_76	0.002	148	318	45	206	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
pfam07944	Glyco_hydro_127	0.002	151	293	70	201	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT71820.1	1.05e-153	27	399	35	405
QDH57403.1	3.27e-147	27	399	35	403
QRQ58333.1	6.56e-147	27	399	35	403
ALJ46800.1	6.56e-147	27	399	35	403
SCV11164.1	6.56e-147	27	399	35	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	1.29e-43	61	393	24	362	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4V1S_A	2.72e-29	102	320	107	324	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	8.97e-28	103	320	108	324	Structureof a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4C1S_A	1.78e-24	44	399	9	373	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	2.78e-22	133	396	226	494	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000010	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001633_00245.