CAZyme Information: MGYG000001633_00387

Basic Information

• Species: RC9 sp000435075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000435075
• CAZyme ID: MGYG000001633_00387
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000001633_3|CGC2	43934.76	8.2933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001633	2721018	MAG	China	Asia

• Gene Location: Start: 65093; End: 66253 Strand: +

Full Sequence      

MKYYIIAGEASGDLHGSNLMKGLYLEDHEADVRFWGGELMDGVYKEHQTGTGLVQDYKDG
AIIGFVQVLMKARTYLGRFKRCFEDISAWNPDAVILIDYPGFNFRVAEWAHKKGFRVYYY
IAPKVWASREGRIKKLKAYVDKLFIVFPFEIPYFTKKGVDFIYKGNPLIDAIDNSPLLKE
TREEFLERNKLEDRPIIALMAGSRSGEISSMMPVFMEFADKMRALPRYKDYQFVVAAAPS
RSMSDYSSYIGGRESYVKVVFGQSYAVLRHAEAAVVNSGTASLETALIGTPQVVAYKSAE
INFLIAKQIIKIKYISLGNLILNRTCFRELLQFYFTPENVLEEVIRMIEDTEYRETMLAG
YKEIRDALGGRGSSAAVAKAMIEDMR

Enzyme Prediction     

No EC number prediction in MGYG000001633_00387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	368	8.2e-106	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.70e-109	1	383	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.08e-104	1	383	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.81e-77	4	376	2	367	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	1.09e-65	1	379	2	342	lipid-A-disaccharide synthase.
TIGR00215	lpxB	4.69e-60	5	383	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAX81022.1	2.42e-115	1	386	1	374
ADY31424.1	7.59e-115	1	386	1	374
SNV26174.1	7.59e-115	1	386	1	374
QYJ69419.1	3.33e-114	1	386	1	370
AZS31618.1	1.99e-112	1	385	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.02e-32	5	383	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.02e-31	5	383	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	1.06e-67	5	378	11	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	4.72e-66	5	383	11	378	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	5.04e-65	5	374	8	367	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	1.58e-63	5	383	11	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	8.46e-59	5	383	9	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001633_00387.