CAZyme Information: MGYG000001633_01543

Basic Information

• Species: RC9 sp000435075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000435075
• CAZyme ID: MGYG000001633_01543
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000001633_26|CGC1	42375	8.9855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001633	2721018	MAG	China	Asia

• Gene Location: Start: 9566; End: 10684 Strand: -

Full Sequence      

MKTAVVILNWNTKNYLEQFVPGVLRSLEGEDACLVVADSASTDGSMQMLAEKFPEVRQIR
LDKNYGFTGGYNRALRQIDAEYYVLLNSDIEVPEGWLKPLVQTMDSCPDVGACSPKLHSW
FEKDKFEYAGAAGGYLDYFGFPFCRGRLMKMLEKDEGQYDRRADVLWATGACLMVRSSLF
NGLGGLDDRFFAHMEEIDLCWRIQLAGYRIRIVPESLVYHIGGGTLPQTSPWKLKLNYRN
NLMLLENNLAKTLALTISEKEKGIDNSGKIAAKAVRQAGRRIWLRMVIDGLTGAAYLLML
KRDYFKAVIDAHKEFRQLSKRPGAEEVNDWLSESAAKRPRPQVQGIYPHWIIPMAIFLRN
KSFGIINKYFQK

Enzyme Prediction     

No EC number prediction in MGYG000001633_01543.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	6	246	3.3e-21	0.8305084745762712

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.18e-52	5	222	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.84e-47	1	239	3	238	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.12e-14	5	152	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.51e-14	5	130	1	128	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1215	BcsA	2.28e-11	35	234	88	273	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF26074.1	1.02e-155	1	363	1	345
QKG79634.1	7.78e-114	2	315	4	292
AGY52836.1	5.37e-111	4	352	5	325
AZQ60830.1	3.17e-110	2	315	11	298
QWG05655.1	6.36e-110	2	315	11	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MLZ_A	2.24e-06	1	110	23	134	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	1.59e-19	5	220	7	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	1.59e-19	5	220	7	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
Q50864	1.49e-12	2	239	575	816	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
D4GU63	2.24e-08	4	253	21	257	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P36667	7.20e-08	65	239	60	242	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001633_01543.