CAZyme Information: MGYG000001635_00725

Basic Information

• Species: Longibaculum sp900538465
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Longibaculum; Longibaculum sp900538465
• CAZyme ID: MGYG000001635_00725
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000001635_6|CGC2	54996.27	5.7962

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001635	2765607	MAG	China	Asia

• Gene Location: Start: 43755; End: 45155 Strand: +

Full Sequence      

MNKEVLKKEMQRVQQDPYRLHYHLMPPMGSLADPNGMCQIGKTTHIYYVHNPMACLTNER
TACVWGHYSTEDFVHFQSHPYAIRPDHPSDKDGVYSGSSLYEDGKLKIIYTGNVRHQGDF
DYVFDGREQNVLMVESSDAICFENKTLLMTNDDFPGNMTKHVRDPQVFKMDEHYYMVLGA
RNQEHQGLALLYESWDMKHWQYLNQLTTSQKFGYMWECPDLIKMNEQMILITCPQGVLQD
DYHYQNSHQCGYFMVDGDWKNDAKLSGFNQFDFGFDFYAARTFLNDHQERILIAWMGMSE
ADYTENMTKKNGWMQAIAMPRKLIYKDRHLYQKPIEAMESLRQSHQHIQLNHGYQVHSLC
FECQIDNIDDQDIMIYFKKDCYLKYHQHILELNLGTCGDGRKIRTVELKKLETLHIFSDT
SSLEIFINDGYYTMTTRLFDLDDLFCIEAIKAQADFYELGKYEINY

Enzyme Prediction     

No EC number prediction in MGYG000001635_00725.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	23	334	4.5e-79	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	3.66e-123	6	439	1	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd18623	GH32_ScrB-like	3.61e-122	29	327	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	4.03e-111	3	439	13	458	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	1.09e-86	23	430	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	4.08e-86	23	334	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY26690.1	1.63e-138	1	464	4	465
QQV06328.1	2.31e-138	1	464	4	465
QMW75218.1	2.31e-138	1	464	4	465
QPS14445.1	2.31e-138	1	464	4	465
ATV62505.1	2.24e-130	12	465	12	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	6.30e-64	22	439	29	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	3.46e-51	17	439	31	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	1.75e-46	18	443	48	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.39e-45	18	443	48	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	5.09e-33	18	430	2	397	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	5.47e-77	16	439	26	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P13394	9.85e-71	14	444	32	457	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
Q05936	3.02e-67	1	439	16	463	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P27217	1.63e-66	16	439	24	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
A1STJ9	2.79e-65	18	439	95	514	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001635_00725.