CAZyme Information: MGYG000001635_02023

Basic Information

• Species: Longibaculum sp900538465
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Longibaculum; Longibaculum sp900538465
• CAZyme ID: MGYG000001635_02023
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	MGYG000001635_27|CGC1	86497.13	5.4948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001635	2765607	MAG	China	Asia

• Gene Location: Start: 13161; End: 15407 Strand: -

Full Sequence      

MNKNYQFQGCWIKGNDIDYGKEDSGYYQDHRNVILVKNFYLDDIQKTYLYIATLGYSIIY
INNQRVTQDELNLVWTQFQKCVYYDQYDVTPYLKKGQNQMKIELGNGMYNPSPLRLFGKY
NLRERLSEVGEPKVLCDLVSCNQVILSSDASWKQGEGHFLFNNLYLGERVDLRLEMSSLK
PVETKENTYHLEANFIPHVRRFQNIQPASLIETKEGIIVDFGEMISGFINLSFHARNRQY
VKLQYSERCVDNQMDYKTCLAGSVGKGIHDFVIPGGLGAPTQAIQTDEIISKEGINHFTN
TFTYHSFRYVLIQGLSKADIHDVYATYVHTDLKQIGNVKTDHSFYNELFDVAMRTKLNNV
HGTFEDCARERLGYGGDMVALAASNLYTFDLEAFYKKIIRDFRYEQTTNGGIPETAPYMG
IQSNGTGQGEGPLLWQLVYPYLTYKHYQYYGDISLLEEEYPYLNKQLNYLLSYDLDEIAE
HCLGDHGSILIAGEFRKPTPDKLLLGYCTMLLFLEYNIAMRHILHKDTTLYQQRYDEIKE
TTIQKFKNEDGSFGKGTQTGYAFAICLGLDDEKILCQKFVEKIQADQGIFNSGIFGMALT
YEILAKYGYHEIIENWLLQESDIGFKAMLSNGNKALAELFVGEQLSLNHAMFASYQQWYY
QGLAGICIENNAVAFDKIKLKPYFSKQVNHVECHVQTKQGMIQSNWQRKNNEIEWIISIP
ENIQYEICLDQEYQKEIIDQQMIIHTLG

Enzyme Prediction     

No EC number prediction in MGYG000001635_02023.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	215	728	5.1e-105	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.83e-44	333	663	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.36e-26	43	176	2	134	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.14e-07	211	322	1	94	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.004	672	729	6	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQV04787.1	0.0	4	735	5	737
QQY28243.1	0.0	4	735	5	737
AUI71217.1	1.52e-245	7	727	10	732
CBL51046.1	4.50e-222	7	727	4	726
AGF56675.1	1.90e-201	7	737	99	850

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.08e-49	44	738	189	907	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	5.87e-34	30	706	129	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	4.78e-56	43	738	196	915	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	9.90e-42	3	733	142	882	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	7.89e-32	30	737	172	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999947	0.000068	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001635_02023.