CAZyme Information: MGYG000001637_02168

Basic Information

• Species: Agathobacter sp900543445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900543445
• CAZyme ID: MGYG000001637_02168
• CAZy Family: CBM86
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1375	MGYG000001637_22|CGC1	148560.06	4.7372

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001637	2652425	MAG	China	Asia

• Gene Location: Start: 31203; End: 35330 Strand: -

Full Sequence      

MWKMGASIALCTAMTLTSVGGMLPVNWGIDTAYADETKAASAKTFTADQLNVAWGNATYE
LTDGKWKLSFAKQYDQVKWSLPEDIELKNVKSVSFKVADQKGSVTLKVYNGGDDATQENT
KYGLSNQEEYSMSPSGDGSIDAVGLMTTDPDGSGSEVSLISVTFELTGDSASEITYGDNI
IKDGDFASTEAAASWNAAAGESSISVAEEENEIGDTGLKSYGIINRDPSTATSGDCFSQD
ITSAVEKGAEYQYSFWAKLSDDYMGAPEEQRNIDFAPFYVAGGEATYLGSYSTGVLSGDC
TKTLTAGEWTKFTGTFKIPNAYDQVVIRIIEQGTNYGQGDCVKGAYCVTGVSMKKITKPK
PEIEQNIPDWRDSVTNAEALGTDAIAGTAVMSNEITDDALMELVEKHFNAVTFGNELKPD
AVFNYQLDNSVQTTTVKFKGEDLLVPVVNENGESMDFSRADAMADKILEWNAANPDKKIR
IRGHVLVWHSQTQEWFFHENYDISKPYVDKETMNRRLEWYIAGVFDHFFGEAANGKYDGL
FYGWDVVNEAVIGNSYRTDKVSAAESLSEIRHGNNSSWWHVYESNEFIINAFKYANKYAP
ENVELYYNDFGETDNTKCEGIVKLINDVKAAEGTRLDGFGMQAHYNVDGFSAAQFKNVAQ
KYAKAAGKVQLTELDFKASSTYDGTDATRESEYTKMAYCHKNLFEAIKDLTKSGTNVSGI
TIWGVIEPNSWLHSQSGVGGGADGTAKQCPLLFDGNYKAKPAYWAYVDASKLQPAIQKIT
ALESKNGNIAGETYSIEQGDLSAEFVPVWDKDGLTVQIHVKDATVNAEDAVTVYVDAANA
ASDVTPVKASVARAEATATTDGYQATVKVPVADLAVAKQIGMDVVVTDGDQKVSFNDLTG
KQETSSKYYAVATMKPGIEKMTYGTVTIDGEADAAWDNATDLPLTINLGSNVTADAKVLW
DEKNLYVYATVKDPVLNKDSGDEYQQDSLEVFIDEDNGKTASYGADDKQYRINYENEQSF
NGKKCLAENVKSQTKRTSDGYMVEAAFKWTDITPANGTKIGLEFQINDADATGKRIGTLS
WYDETGMGWSGSNVYGTVELTGKTSGGSSSGTPSTSGGNSGSSSTDKPNDGADSKSDVTT
DTKPDGSTIETSKVEIKAGDSKTEASVSVTKDKDGNVTAATATVASGKGTISADVVKQLK
EAAGTDDVTVKLEVKDASGNAKYTVSIDAKHVKPNTSLKVVAVNKKTGALELVNNKTYKT
DKDGNVSVSFKQGADYKLLTIKEATKLEKEVLKNVAPKKAKVSVKKGKTTSFAFSSKLNP
NNVKKINYKTTKKSVASIDKNGKITAKKKGTATVKATVTLKNGKTKTVKMKITVK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	383	769	2.8e-81	0.9636963696369637
CBM9	928	1100	3e-51	0.9945054945054945
CBM86	53	162	2.9e-37	0.9906542056074766
CBM22	179	329	1.3e-18	0.9618320610687023

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00005	CBM9_like_1	6.94e-79	922	1100	5	184	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
pfam00331	Glyco_hydro_10	8.91e-67	387	768	13	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	6.12e-66	455	765	13	262	Glycosyl hydrolase family 10.
pfam06452	CBM9_1	3.01e-56	928	1100	1	181	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd20907	CBM86	1.78e-45	42	167	2	127	carbohydrate binding module family 86. This family describes what is most likely a xylan-binding module such as found in the Xyn10A protein of Roseburia intestinalis L1-82, which is involved in the extracellular capture and breakdown of xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV24088.1	0.0	2	1100	5	1101
EEV01588.1	0.0	14	1100	1	1085
CBL13458.1	0.0	14	1100	1	1085
QJU17095.1	1.98e-279	168	1101	221	1147
BAA09971.1	1.68e-263	161	1098	26	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W5F_A	1.62e-51	210	763	50	521	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
6SGF_A	2.73e-50	43	178	7	141	Molecularinsight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_B Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_C Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_D Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_E Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_F Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82]
2WYS_A	3.54e-49	210	763	50	521	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WYS_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
1I82_A	1.19e-44	923	1100	7	187	Family9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Cellobiose [Thermotoga maritima],1I8A_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Glucose [Thermotoga maritima],1I8U_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a [Thermotoga maritima]
6D5C_A	2.78e-44	368	769	16	350	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36917	1.11e-101	238	1106	246	1048	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
P38535	1.25e-94	351	1106	191	900	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
Q60042	1.22e-93	303	1100	301	1053	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1
Q60037	2.04e-90	303	1100	305	1057	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1
O69230	3.32e-84	240	1103	250	1086	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003144	0.995407	0.000368	0.000501	0.000294	0.000248

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001637_02168.