CAZyme Information: MGYG000001639_00172

Basic Information

• Species: Haloferax massiliensis
• Lineage: Archaea; Halobacteriota; Halobacteria; Halobacteriales; Haloferacaceae; Haloferax; Haloferax massiliensis
• CAZyme ID: MGYG000001639_00172
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000001639_1|CGC4	33445.89	5.2105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001639	3991467	Isolate	not provided	not provided

• Gene Location: Start: 192269; End: 193159 Strand: +

Full Sequence      

MNYPGSFNTIIVDGHSKDDTISIAEKYDCDVIFEDKGTISYARELGVEKSDSEFVAFTDA
DCVVPENWLSTLINHFDDNGKVAAVGGPNITPEDDSTFAKSVGDVLSLLSGAGARYGFEG
KETREIYHNPTCNVVYRREVIEEVGGFNHDLITVDDEEMDYRIREQDYKILYTPEAEVLH
YRRPSWKSFTKMGYRYGLGRAQATKLHPEMGEWFHFAPSSIILLLALFLGNAVRSRSWVK
RFAGTLSLGVMGIVSMSVFLSAKRNRWTQLPVYVILISIWFWSWGVGFIKGLCQNT

Enzyme Prediction     

No EC number prediction in MGYG000001639_00172.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	145	1e-18	0.8294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02525	Succinoglycan_BP_ExoA	1.88e-48	3	218	27	245	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd04192	GT_2_like_e	2.34e-20	2	189	23	219	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	4.43e-20	10	172	30	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1215	BcsA	1.04e-18	1	289	80	395	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG1216	GT2	6.87e-18	10	238	36	278	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7775952.1	2.08e-120	10	292	45	324
CAD7776109.1	2.08e-120	10	292	45	324
BAZ98379.1	1.45e-90	1	292	39	331
QNO54488.1	8.88e-89	1	294	28	320
BAW28455.1	7.26e-47	1	289	29	319

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GYH2	2.33e-16	8	209	40	236	Glycosyltransferase AglI OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglI PE=1 SV=1
A0QSC1	1.32e-11	42	230	146	329	Pre-mycofactocin glycosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mftF PE=3 SV=1
D4GYG7	3.22e-11	1	206	31	233	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
P46370	3.37e-11	40	207	192	356	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1
D4GYH3	7.47e-09	34	180	66	216	Glucosyl-dolichyl phosphate glucuronosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
213	235
242	260
270	292