CAZyme Information: MGYG000001639_00376

Basic Information

• Species: Haloferax massiliensis
• Lineage: Archaea; Halobacteriota; Halobacteria; Halobacteriales; Haloferacaceae; Haloferax; Haloferax massiliensis
• CAZyme ID: MGYG000001639_00376
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000001639_1|CGC5	36048.53	4.3043

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001639	3991467	Isolate	not provided	not provided

• Gene Location: Start: 398685; End: 399671 Strand: +

Full Sequence      

MLASLTLALVSLGVAVGLLGTLAESDDPDEYDYVVAKDGSGDYETIQAAIDGAKSFPPDR
IRILVRGGVYDEKVEVHAWNPDVTLVGESAAETVITHGDHFEKIDRGRNSTFFTYTLKVR
GNDFRARNLTVENSAGPVGQAVALHVDADRAVFENCRFLGHQDTVYAAGEGARQYFSNCD
VEGTTDFVFGGSTAVFEDCRVHSKADSYVTAASTPESEPFGFVFLDCELTADPDVSEAYL
GRPWRNYARTAFIRTRMGSHVLPAGWHNWSRPEAEKTVEYAEYDSRGPGSEGERVPWATA
LTEAEAERYSKANVLGSEGDGEWWDWEE

Enzyme Prediction     

No EC number prediction in MGYG000001639_00376.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	33	315	1.1e-101	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	2.75e-90	32	316	1	296	Pectinesterase.
PLN02773	PLN02773	3.42e-85	35	325	9	306	pectinesterase
COG4677	PemB	7.98e-73	2	315	59	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	1.37e-72	35	319	15	290	putative pectinesterase
PLN02708	PLN02708	2.30e-71	32	323	242	548	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS13021.1	8.97e-227	1	328	1	328
AKU07896.1	2.46e-224	1	328	1	328
QIB78898.1	6.21e-208	1	327	4	333
ADE03849.1	3.60e-192	1	328	4	358
QLH84660.1	3.34e-154	27	320	5	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.53e-46	34	305	10	294	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	3.38e-46	34	297	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	4.08e-36	41	326	17	294	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.18e-35	41	326	17	294	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
2NSP_A	2.12e-30	31	316	4	335	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	4.12e-62	35	323	9	304	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	8.34e-58	11	315	268	592	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9FJ21	2.77e-55	34	315	261	553	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q8GXA1	7.15e-55	28	297	253	531	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LXD9	1.03e-54	32	315	240	541	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.300556	0.696692	0.001330	0.000440	0.000380	0.000583

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001639_00376.