CAZyme Information: MGYG000001639_03138

Basic Information

• Species: Haloferax massiliensis
• Lineage: Archaea; Halobacteriota; Halobacteria; Halobacteriales; Haloferacaceae; Haloferax; Haloferax massiliensis
• CAZyme ID: MGYG000001639_03138
• CAZy Family: PL42
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		62868.53	4.2372

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001639	3991467	Isolate	not provided	not provided

• Gene Location: Start: 35769; End: 37445 Strand: +

Full Sequence      

MTFEDQNEKQAEQNGTESAGKMFSLKRERLLSGEAWAFNNAPWDQRKVVTVGDYQYVPYW
NDDGVLSLARRALPTDSVQCIQFDWRVPDEDSHRNTALGTDNDGRLHLAYDHHDDPFHYR
YSSSGFLTDPPSSVSTGDFSETTDMGLSGPERPVTYPRFFNDQRGTLFCEYRIGSSGDGD
SYLHVHDSPSNSWTRIGTVFSSAGTYEPWNGSASRNAYHHDWTFDDTGRLHVTWTWRETW
ETWRSNHDIHYAYSDDGGYTWCNNDGTVIGDVNADDPIRVDDESVVVDGPARSWLINQGT
QALDSNDQPHIFTSRSTDSTTDFDDANRHYIHYWRTTDGQWHEQYIDDTSVDLSTVGIDP
TRAGDILLDRGDLLFDDNDALHVYTVVDGRLYAGVATASSGWTDWTLYCLHEGPFCGMDG
RKHDTCRWENESVLSIPLERPRENGTAFVLQEYSIVGPNDPSAPSLSVSNESSSSVELSW
TEARGAESYTLHRRPVDGDFEVVADEIAENSFYTQYTDTRVSSGSDYEYRLTAVNSVGET
DSTIVRVTTDGSSNAAME

Enzyme Prediction     

No EC number prediction in MGYG000001639_03138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL42	39	355	6.9e-80	0.972972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15892	BNR_4	1.12e-70	54	342	1	267	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.
cd00063	FN3	0.003	480	549	21	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT46315.1	9.43e-132	38	538	64	566
AJR04497.1	2.37e-57	37	439	46	452
QCT04044.1	6.09e-56	39	453	59	466
QDU55112.1	3.30e-52	39	445	59	473
BCB83260.1	1.48e-51	39	457	8	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESK_A	3.51e-42	39	405	24	371	ChainA, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum],7ESM_A Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESL_A	3.51e-42	39	405	24	371	ChainA, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESN_A	6.50e-41	39	405	26	373	ChainA, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
5MVH_A	7.62e-38	39	443	36	406	GlycosideHydrolase BACCELL_00856 [Bacteroides cellulosilyticus DSM 14838]
5MUM_A	9.73e-37	39	443	41	411	GlycosideHydrolase BACINT_00347 [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A109PTH9	1.10e-06	66	329	118	427	Ulvan lyase, short isoform OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_107 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001639_03138.