CAZyme Information: MGYG000001640_00642

Basic Information

• Species: Duncaniella sp900549445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900549445
• CAZyme ID: MGYG000001640_00642
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	MGYG000001640_20|CGC1	63524.79	4.3608

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001640	2860567	MAG	United States	North America

• Gene Location: Start: 44; End: 1786 Strand: -

Full Sequence      

MKIRNFLLAATLIFGGTFAVSSCSDDDDDRAKPEFIGPDFAVSKTEVALAGAKPSSITVK
APVRPTVTSDAEWLHVGEITSSLNGNIYNVAIQADENSTFDTRTATLTITAGSEKTTVRV
TQYGNETVQIVSVTPSETLDPNGGTVSIKYAATGEVSVDYPAWLVVSRSLSDDVINFTYS
ANFSDEARTANVVFTLDSDPEITASVTLSQAKTEVSEDMSLNAMQLAAKMYAGVNIGNTM
EVPTGETGWGNPVVNKEYIKGLKALGFNSVRIPCAWDSHVSDPATNTIDPAWLDRVNEVV
GWIVEEDMYAIVNCHWDNGWLEENVHKPFDEAINKKMHDYWTQIGNKLNRYDQHLLFSGM
NEPGIQNGLEGPTVENIIKYAQTFIDAVRDTGGNNALRCLAVSAPNTNIDEAVKPAFRNN
FPTDRVEGRLFVEVHYYDPSDFTIMSSDGQWGSKVKLYWGEGNLVPGSDRNCTWGDAAFM
NGQFKKMQDSYVLSGIPVILGEYASDANRSKTDFPDMDVDKWKASRADWTKCVTDYAKDN
GCVPFYWETGGDISRTNGTAKNAYVITALMEGAAAGIYPF

Enzyme Prediction     

No EC number prediction in MGYG000001640_00642.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	246	550	3.1e-90	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.24e-46	243	547	13	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.30e-15	218	547	39	357	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	3.13e-12	40	122	2	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	7.63e-09	39	125	1	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam13004	BACON	7.76e-09	66	123	4	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42340.1	9.19e-259	1	580	9	593
QUT37093.1	5.08e-151	2	580	8	593
QQA29804.1	1.83e-148	2	580	8	593
QUT65987.1	5.18e-148	2	580	8	593
QUU01445.1	5.18e-148	2	580	8	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OYC_A	1.44e-86	216	575	38	395	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
6HA9_A	1.12e-85	216	575	38	395	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
4W8A_A	1.52e-73	222	580	2	378	Crystalstructure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W8B_A Crystal structure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with XXLG [uncultured bacterium]
3ZMR_A	4.64e-64	139	572	1	465	Bacteroidesovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus],3ZMR_B Bacteroides ovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus]
2JEP_A	7.42e-60	222	572	34	393	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT7	4.79e-63	145	572	62	500	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
O08342	9.25e-58	212	572	29	398	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28623	3.04e-49	223	572	43	371	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P28621	3.28e-47	205	575	27	376	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	3.65e-40	221	579	55	389	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000070	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001640_00642.