CAZyme Information: MGYG000001640_00829

Basic Information

• Species: Duncaniella sp900549445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900549445
• CAZyme ID: MGYG000001640_00829
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		39251.16	4.9

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001640	2860567	MAG	United States	North America

• Gene Location: Start: 4923; End: 6002 Strand: +

Full Sequence      

MKTLLPILGIALTGAIAISCAQKTETVISPSDPLIAYTGRIDRSNPESYRFSYPGTSAEI
IFDATSVTLDATPGAGSFMVEVDSLPARKVTIAETDSTVVIADSLAPGEHRLKIIYAQEG
YEARPALRGFRLSPGGKLIRKPEPAALRMEFIGNSITCGYGIESDDPKEGFSFPTENHYY
SYAARTARALGADYCTVARSGIGIYRNYGSPIEGSDMDMPDIYGRTLYYEAEPSWDFSEF
TPDIVCVNLGTNDTSLDTYSTDSIYNAFSTFHSRLRSNYPKAKIVYLTGAMLGGKALEDV
RTILDKMTAQKRAGADSLVYRFDMTPQDGSLGYGADYHPSRRQAEKMASELTGFIESIR

Enzyme Prediction     

No EC number prediction in MGYG000001640_00829.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	148	355	4e-61	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	3.88e-37	148	356	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	1.41e-29	37	138	1	104	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam13472	Lipase_GDSL_2	4.50e-10	151	340	1	170	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01827	sialate_O-acetylesterase_like1	4.99e-10	152	351	6	183	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd00229	SGNH_hydrolase	3.21e-08	151	351	3	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41872.1	3.58e-114	10	358	13	358
ADY36201.1	7.04e-114	22	358	29	366
QCD38714.1	3.43e-112	19	355	22	355
QCP72402.1	3.43e-112	19	355	22	355
ADE83543.1	3.11e-90	27	358	29	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	2.59e-55	32	357	8	329	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	7.21e-55	32	357	8	329	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
4XVH_A	4.77e-24	35	340	2	308	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]
2W9X_A	9.89e-23	44	356	43	354	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	2.31e-51	21	357	479	810	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PDE5	5.04e-22	44	356	43	354	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001640_00829.