CAZyme Information: MGYG000001640_01412

Basic Information

• Species: Duncaniella sp900549445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900549445
• CAZyme ID: MGYG000001640_01412
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755		82729.85	5.2942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001640	2860567	MAG	United States	North America

• Gene Location: Start: 6898; End: 9165 Strand: +

Full Sequence      

MKKSLITLAAAAFLFAGAASAEKPLYKNPKAPVSARVDDLLGRMTLREKVQQLQNNSISN
PSELSGRYGKVSPGSVHEMGLSAYDASVLFTEMQKYLRDSTRLGIPALTSCEGIHGLIQN
GATIFPQAIAQGSTFNPALIERMTGAIADEARVMSISQLLSPVLDIARELRWGRVEETFG
EDPYLIGEMATAFVNGAQKKNVGCMPKHFVAHGTPAGGLNCAHVAGGEHELRNLYAYPFA
KVFRNAHPVAIMGCYSAYDGVPMAGSRYYMTDFLRGELGFDGFAYSDWGSIDRLKVFHNC
VATTEEAGRQALMAGMDMDVWDWAYTSLEDQVKNGLLDEKYIDTACRRVLEAKFRLGLFD
EITGDPKKVGKVVRSKANVALAKEIADESAVLLENNGILPLDIKKYRKIALLGPNSDFGV
AGDYGWINAWDKECVSLNDALRSKLAGKAEIVQADGCDWWSQDDSRIAGAVKLAEESDLA
IVAVGTRSLWLGRSAKDHNVTSGEGFDISSLDLPGRQLDLLKAVKATGKPMIVVLITGKP
LVMSWVKDNADAIICQFYAGEQQGNALADILLGDVNPSGRLNVSFPRSTGNTPCYYNYYT
SDREQVFDKGGSLSDPEGHYIFERPYALWNFGRGLSYTTFEYGEPRFSADTFGPDDTLTV
EVDVTNTGNRDGKETVQLYVRDVISSVSTPDRMLRAFSKQNIPAGETRTFTLTLPMQELR
LYNIDRKYVVEPGDFEIQIGAASDDIKSTKTITVK

Enzyme Prediction     

No EC number prediction in MGYG000001640_01412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	99	320	2e-65	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.03e-155	35	748	36	759	beta-glucosidase BglX.
COG1472	BglX	2.53e-80	44	426	1	371	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	6.03e-72	28	740	44	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.91e-65	45	352	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.88e-60	390	621	1	214	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61926.1	0.0	1	755	1	753
ABR38447.1	0.0	24	755	28	757
QQY38586.1	0.0	24	755	28	757
ALK83130.1	0.0	22	754	26	756
QQA08973.1	0.0	22	755	26	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.10e-168	22	755	3	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	8.71e-168	22	755	3	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.33e-119	26	754	36	785	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	5.59e-113	37	750	14	748	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.02e-112	37	750	14	748	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.01e-128	92	755	52	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	2.48e-108	26	749	29	750	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	5.50e-103	35	747	36	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	5.74e-102	19	747	18	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
A7LXU3	1.58e-95	1	751	4	773	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000255	0.999058	0.000194	0.000165	0.000150	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001640_01412.