CAZyme Information: MGYG000001640_01642

Basic Information

• Species: Duncaniella sp900549445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900549445
• CAZyme ID: MGYG000001640_01642
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
872	MGYG000001640_83|CGC1	97983.51	6.3252

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001640	2860567	MAG	United States	North America

• Gene Location: Start: 362; End: 2980 Strand: +

Full Sequence      

MRTIKIIKKVAFGLLLAMSSLAGFASSSVLPVNPEGKSFTLLPEIVCDDRGTDMDFPIVD
MEGKAAAIICDENDFKGVRRAAADLAEDISRVCGVKPRQAELVSVSPSIIVGTLGKSRLI
DDLVEKGCLDVSGLRGKWESFCITTLEGDTPRLVIAGSDRRGTIFGIYELSEQLGVSPWY
WMADAPVKKRVSAYVAAGSYASGEPKVKYRGIFINDEWPSFGTWCNNLFGGINHKAYEKI
FELLLRLKANYLWPAMWASAFNEDDPLSPQMADDYGIVMGTSHHEPMMRAHKEYTRKRHE
VGPWDYSVNAKRLDRFFREGLSRNRGHDNIITIGMRGDGDVAMGKGDDADNMATLRKVIR
SQRRIIKDVYGRGPETVPQLWAIFTEVQRYYDAGFTVPDDVTLLFCDNNWGYIRRKGRES
ERKRSGGMGLYYHIDMNGGPWNDRWVNTTTVPKIREQLNLAYRSGIDRIWIVNVGDLKPK
EMPIDFIMRYAWDPDRIGPGDERGYMERFAASVFGDDHASEIADLISSYSKYNLWRKPEV
QYPGIFNIPEMLVLNNMWSNLELRAEGLRRKLPKEQQDAFFQLVYYPVVGSATVAHIYNS
ASIGDAENINLLMEKDRELTAFYNDSLSGGKWRGMMLDNHIGYTKWSIPDSNQSPLDLGL
GFDHSLIHSSDSREKYIPAHAFSRKTAGNGVEWIFLPDLGRGKGCMGSSDVMAESGTQGL
RATLEYDVVADADTLTVAIGILPTQDIWPERGLRLGVSTDDGPLQILDARRGLVDTFGEY
NKSNLAVSKVLSPLPKESHLALSGYFGGKRLPMRNEVFDNIRWLDTSFQVSPGKHTLKIV
MIDPEIVVEQIVVNPDNSRYGYFPHGFFDSLK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	62	851	1.5e-231	0.9870875179340028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	203	540	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	4.53e-26	677	863	11	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.34e-04	81	170	36	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEC55419.1	0.0	37	862	24	985
QRQ50360.1	0.0	40	862	2	960
QUT25621.1	1.06e-297	36	862	25	1001
ALJ47135.1	1.85e-297	24	862	9	997
SCV06546.1	2.12e-297	24	862	13	1001

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	1.52e-176	62	656	19	630	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	1.54e-176	4	862	9	843	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	9.28e-171	62	647	22	636	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	4.30e-168	62	647	21	635	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	1.75e-128	35	656	1	654	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.101027	0.874509	0.022840	0.000883	0.000364	0.000365

TMHMM  Annotations     

start	end
12	34