CAZyme Information: MGYG000001643_00780

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000001643_00780
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797	MGYG000001643_15|CGC2	89775.71	6.9228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001643	4013444	MAG	United States	North America

• Gene Location: Start: 24098; End: 26491 Strand: +

Full Sequence      

MKCFHMNFIMKKKYLLILAFAAALSGSAQTKLYPNEFSLSDVKLLESPFLHARDINVKTL
LAYDVDRLLAPYLKEAGLEPKAPSFSNWDGLDGHVGGHYLSALAIHYAATGDKALKERMD
YMLSQLAMCAVARGDGYVGGVPNGEPLWKSLKSGEPGMVWKYWVPWYNVHKMYAGLRDSW
LYGGSEVGKKLFLGMCDWGIDVIANLDDKKMEQMLDNEFGGMDEVYADAFAITGDRKYLD
AAKRFTHHQLFDGMLAGVDNLDNRHANTQVPKVVGYQRIAELSGDADYEKAAEFFWNTVV
KNRSLSIGGNSRREHFASKADAKSYVDDREGPESCNTNNMLKLTEGLFRMNPDARYADFY
ERALYNHILSTIHPEHGGYVYFTSARPGHYRVYSKPNSAMWCCVGTGMENHGKYGQFIYT
HSGDSLWVNLFMPSELNWRDKGIRLTQTTSFPEDGNVKFTVNSDSARTFSLLLRHPGWCD
NLAVKVNGKKVKTASKPSSYLSLNREWRDGDVIEMEMPMKVTLEELNYLPSYVSILRGPI
VMAARIESDAPLTGLVADDSRWGHIAHGPLVSVFDTPLLIGKRADLLKKLNKMQPAGGMK
YTVPGLFEGKYSGLVLEPFYNIHDSRYNMYWLSMTPAQYASYKVNAQRDEEMRLALDRRT
VDAVNTGEQQPEADHFMESRSSASGNFNGEPWRDASNGGFFSYKMKTDGRNDLTLRVRYW
GNESGSRAFNILVDDNVLTAEDIAGKWNKDGFVDAEYAIPPHYVEGKDFIRVKFASDKGQ
TAGGIYHVRLIRPETAD

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	41	543	2.5e-199	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	41	543	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.50e-118	59	544	29	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	5.37e-32	552	631	5	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43163.1	0.0	16	795	7	788
QCD36520.1	0.0	17	794	11	788
ADY37333.1	0.0	10	792	1	796
SCV06553.1	0.0	28	794	23	799
QRQ58640.1	0.0	28	794	23	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	6.64e-227	17	792	7	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.82e-220	17	792	7	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	3.66e-28	279	551	279	568	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.22e-27	279	551	279	568	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.75e-26	228	541	250	605	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.27e-13	71	544	121	567	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.028927	0.744914	0.225161	0.000412	0.000294	0.000262

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001643_00780.