CAZyme Information: MGYG000001643_01356

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000001643_01356
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851		95042.11	5.3481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001643	4013444	MAG	United States	North America

• Gene Location: Start: 33437; End: 35992 Strand: +

Full Sequence      

MDMRRFGIALALAAAVFNCKAATIQITTDGDGASGYFQLKGKPVVFDPDDSEVVKNVADM
LAGDLYEVTGCHPDIVSGELPSATDAIVVGTLGLSAAVDSLASAGVIPADSIRGGWERFI
IKTVTADEGRRLLVIAGSDRRGTAYGVTTLSHAIGVDPWVWWADVPVARCPEIGVRADYV
SAAPSVKYRGMFINDEDWGLLPWAAAGLDSDIADIGPHTYEKVCRLLLRLKGNMLAPAMH
SCTGAFYSHPESKVVADRYGIIITTSHCEPMLFNNAALSEWNPQADGEWDYALNGEVIRK
KFSDRLDEAAPYENLYTVGMRGVHDEAMSRQRPKEERVALLDRVIADQRAMLSSKFGRPA
SEIGQIFVPYKETLDLYRNGLHLPDDVTIIWPDDNYGFMKSLSNPEERKRSGGAGVYYHT
SYLGTPHDYLWLCTTPPMLMYHELRKAWLNGADRYWLLNVGDIKPAELDIQTFFDMAWNV
DCFDYDNVNDHQPAMLARIFGEGLKNEFKAILSEYYRLAWIRKPEYMGWEIEWDSPDRAD
TGPTDFSFGNYGDAVKRIEDYAALSARTRRIMDALPDSLWSPFFELVGYPVFASEMMTRK
YLFAQLNGELAAGSDKLGANYAARLSEEACDSIDSLGRIFNRMEDGKWKGIMSVPPGFCA
KYQNPPHLRHFPDAGERMVTFAPQVIAPKCRTLDLRKFKGDKGHEKRKARILEGIGYDGF
ALQLGEAADDAGGEGVEVSYRFDMTKGDSVTLRIFHLPFFPLYEGKKCRIGVSVDGGKEE
VAEYLPEEWSKEWKINVLRNSAMTTLRLPLRKKGRRHELRLRGIDPGMVVQRIVIDEGGF
SPGYVGPDLVR

Enzyme Prediction     

No EC number prediction in MGYG000001643_01356.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	42	833	9.7e-210	0.9813486370157819

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	4.65e-166	183	525	2	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	pfam17829	3.27e-24	710	848	28	171	GH115_C Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	2.98e-04	81	147	58	117	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ80642.1	2.55e-239	37	833	20	792
ALK86808.1	7.09e-238	19	848	18	962
EDV07546.1	3.53e-232	19	848	17	961
APZ45930.1	2.73e-227	8	848	9	955
AUC19792.1	2.73e-227	8	848	9	955

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	2.90e-155	41	837	25	775	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	2.52e-107	43	845	54	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
4ZMH_A	7.66e-103	44	665	25	623	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	5.74e-93	40	841	22	825	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.49e-91	40	841	21	824	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999040	0.000200	0.000176	0.000177	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001643_01356.