CAZyme Information: MGYG000001643_01538

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000001643_01538
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000001643_40|CGC1	43400.1	4.8744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001643	4013444	MAG	United States	North America

• Gene Location: Start: 5812; End: 6972 Strand: -

Full Sequence      

MCRFFMFFGILLASVGIRAETMSELKDRVFRLAEIQYVAIDSILCDGEFPTSATGEGELV
ASGINWWCSGFYPGCLWYIYEYGGSQSVRELAVRHTERLDPLKYVTTDHDIGFQLNCSFG
NGYRLTGNPDYLKVLEKGARSLATRFNATTGVLKSWDFVMDGRDWKYPVIIDNMMNLELL
MVAAASSGNEGLRKVACSHAETTMRNHFRPDFTSFHLVDYDPESGLVRSKETVQGYSDDS
SWGRGQAWALYGYTMMYRLSGDNRFLSHAEGVADMLLSRLPADGVPQWDFNAPADIGYRD
SSAAAIMASAFIELGKLTSEKERGEKCLDMAERQLRTLASPEYLAEEGRNGHFLLKHGVG
NYPACSEIDVPLVYADYYFLEALLRY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	63	386	2.9e-121	0.9848024316109423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.03e-10	67	259	29	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO70964.1	2.25e-171	18	386	19	385
QUT90613.1	5.23e-170	18	386	19	385
QUT26394.1	1.57e-167	9	386	10	388
SCV07260.1	2.23e-167	9	386	10	388
QRQ54741.1	2.23e-167	9	386	10	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	2.02e-103	31	386	37	388	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	8.67e-54	18	386	21	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	8.88e-54	18	386	22	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.24e-53	18	386	22	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	4.81e-53	18	386	22	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	2.26e-90	49	385	58	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9A0T3	3.55e-53	48	386	51	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	4.86e-53	18	386	22	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	2.68e-49	49	385	24	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8DR77	5.83e-49	20	386	25	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000411	0.998931	0.000154	0.000171	0.000150	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001643_01538.