CAZyme Information: MGYG000001643_01967

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000001643_01967
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	MGYG000001643_57|CGC1	98933.04	5.3698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001643	4013444	MAG	United States	North America

• Gene Location: Start: 20827; End: 23400 Strand: +

Full Sequence      

MRQTVISVVSSLLMGATALSPTSFAARIELNDGWKFKQSKTSEWHPANVPGCVHTDLMAL
GKISDPFFGVNEKELQWVGEKDWEYINIFKATPEVLSSPDIDLVFEGLDTYAEVYVNDVK
ALDADNMFRTWRINARPYLKEGDNVIRICFRSVFKEDMPKYLDAPFKLQAWPNNDQSDIP
LSLYARKAGYNYGWDWGPRLITAGIWRPVYLEVWDGVRIDGAHVATRSLEKGHASMEAVC
DIVSDSDCFASVSVVFDGGRATKEVSLEKGSNRVRIPFKMKNPKLWWTNGLGDHPLYDFD
ISVRTDGKEVLDRVTTGIRTVEVVRDKDKYGTSMKIRLNGKDVFMKGADWIPMDNFPNRV
TKTRYEQMLGSAADANMNMIRIWGGGIYEPDIFYDICDRKGILLWHDMMFACGMFPADDR
YLHSVAEEVKDNVKRLRNHPSIALWCGNNENEISYFEWGWRGKYTPEQDRIYQSNLKKLF
YDVIPEAIKEYDDTRYYHPTSPVTGYNGIGYGEGDAHFWWVWKGGWIEEYLKPENIARFM
SEYGFQSYPEMKTIESFTREEDRHIDSEVMLSHQRARHDQTRDPNFGNNMMRMYMEKYFS
VPEELDDFVYVSQIMQAEAVKTAIESHRRSKPYCMGTLYWQIDDCWPVASWSSIDYYGRW
KALHYTARDAYRDVIVSPYEKEGKVAFKVVSDRMNPVSGELLVTTMTLDGSNVYSRRVPF
SVGANGCDDVAVVEEKELYGDKNPEEVFTFASILQNGKEVSSNIWYPVYSNRYSYLEANP
EIKVMAGENEVILVATSPVLVRGLYFYLDVDGDDAFFSDNYVTLVPRKEHTIRVRTSLSP
DILKKRLRFKALNNLKY

Enzyme Prediction     

No EC number prediction in MGYG000001643_01967.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	752	8.3e-104	0.7180851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.76e-103	27	718	12	678	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	1.49e-13	683	768	1	87	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	5.22e-09	105	498	132	473	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	1.03e-08	217	319	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	1.43e-08	779	854	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT80947.1	0.0	12	855	10	854
QDM12230.1	0.0	12	855	10	854
SCV10456.1	0.0	12	855	10	854
QRQ57690.1	0.0	12	855	10	854
ALJ46104.1	0.0	12	855	10	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	6.11e-198	30	844	11	823	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	6.50e-198	30	844	13	825	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	6.70e-198	30	844	13	825	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.77e-197	30	844	11	823	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	7.63e-196	30	844	11	823	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2QYN2	1.26e-122	26	852	5	842	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
A1CGA8	2.52e-122	27	835	6	829	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
A1D911	6.92e-122	30	835	9	829	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	7.27e-121	30	835	9	829	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
Q5B7W2	9.70e-121	30	835	9	827	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000348	0.998873	0.000172	0.000254	0.000185	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001643_01967.