CAZyme Information: MGYG000001643_01986

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000001643_01986
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		69734.58	5.2457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001643	4013444	MAG	United States	North America

• Gene Location: Start: 85; End: 1908 Strand: -

Full Sequence      

MWAWAFYADDPENSRIADEMGVIIGTSHHEPMARNHQEWARNRKKYGAWNYATNKDTIDK
FFKEGIMRMKGTEDVVTIGMRGDGDEAMSADADVSLLKKVIANQRKTIARETGKKAAETP
QVWALYKEVLDYYDAGLKVPDDVTLLLCDDNWGNVRRLPNEKERQHPGGWGMYYHVDYVG
APRNSKLLNCTPIQNMWEQLQLTYDYGVDRLWILNVGDLKPMEYPITLFLDMAWNPKAFN
ADNLLDHTKRFFEQQLGEDQAAEAARIFNMLCKYNGRVTPELLDRNTYNLQTGEWKRVVD
DFARLETAALRQYITIEDRYQDAYRELLLFPLQVMSNLYEMYYAQAMNHDLHSKGLPEAN
VWAEKVSECFERDKYLMNEYNHVIADGKWNGMMTQKHIGYTSWHDGFDADTLPETFKMGN
TDDGGYVHDFSDGYVAMEAEHFFGCENPSSSAKWTKIPYMGRTLSGMAVMPYTENAEGGS
LEYRFRLPETVDSVTIHVIVKSTLAFSRLDGHRYSVALDGNTPETVNFNGNMNEAPENVY
TNYYPVIARRVVEKKIKSDVARTDDGTHTLRLAPLDPGVVFEKIVIDYGGYQPSYLFGEA
SPKKKLK

Enzyme Prediction     

No EC number prediction in MGYG000001643_01986.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	1	584	1.2e-184	0.7173601147776184

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	7.73e-166	1	282	55	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.59e-44	431	596	5	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR44901.1	0.0	1	605	237	842
QUT26893.1	0.0	1	605	237	842
QDH54071.1	0.0	1	605	237	842
QUT32427.1	1.20e-317	1	605	237	842
QRM99002.1	1.20e-317	1	605	237	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	3.41e-317	1	605	248	853	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.20e-294	1	607	221	840	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	8.79e-292	1	607	220	839	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	7.48e-112	2	603	220	935	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	8.88e-80	1	405	217	647	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001643_01986.