CAZyme Information: MGYG000001643_02104

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000001643_02104
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1155	MGYG000001643_65|CGC1	130002.01	5.6359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001643	4013444	MAG	United States	North America

• Gene Location: Start: 1423; End: 4890 Strand: -

Full Sequence      

MRNRMISAFLFALVLLPCRAEGLRGFFYGDDKAPGGHEWECPDSLAHNPDSLAYNKEQPR
AWFFTFADEESARKVLPEYSRYWKSLDGDWKFHWAGNPSERPIDFFKPDYDVSGWDNIRV
PSNWNLAGLQKDGSLKYGKPIYVNQKVIFRHQVKPDDWRGGVMRTPPEDWTTFKNRNEVG
SYRRTFTVPAGWKGREVYLNFDGVDSFFYLWINGKYVGFSKNSRNAARFDITPYIKRKGE
NTVAVEVYRNSDGSFLEAQDMFRLPGIFRSVYLTSASPVEVRDLVVVPDLVNDYNDGKLS
IKASIRNLSGKNMKGCRMVYSLYSNPLYDDRNEAVKDGNVRSDAIDIPSGSEGELSAVLK
VRNPNKWSAEEPWRYTLVGKLLDGKGRVLETVSVYTGFRKVEIADVEADKDEFGRKGRYL
LLNGKPVKFKGVNRHETNPWLGHAVDRGTMTEDIMMMKAANINHVRNCHYPDAPYWYYLC
DKYGIYLEDEANIESHEYYYGDASLSHVDEWEAAHVARDMEMVHSTVNSPAVVIWSLGNE
AGPGKNFVSAYNAIKGFDTSRPVQYERNNDIVDIGSNQYPSIAWVRKAAEGALDVKYPFH
ISEYAHSMGNAVGNLIDYWEAIESTNHIMGGAIWDWIDQSLYNYDPATGECYLAFGGDFG
DAPTDGQFVMNGLLFGDMTPKPQYYEVKKVYQNVAVKAVDIREGKIEVFNKNYFTPLDGY
NVVWKLLRDGVAVKEGTLDELSRRPLGPREKGTYQVPFDYSSLSPEGEYFLNIEFRLVGD
KPWAQPGYVQMAEQLPVKSCEAQPGSLGVNSSATPDYTVAGDIATVAGPGFVAEFDIEKG
MLHRLEYDGADVVKPGRGPRLDAFRAYVNNDAWIAEKWFEKGLYNLQHRVLSKIIEEDAS
GAVRLTFMVESQASNGGKMIGGNGNAKGTYSIDETGSRAFGPDDFKFVSLQTWTVRGDGS
LEFSGNVTSNDSSMILPRLGFSMEVPKGLSDVAYYGRGPEENYNDRKSGQFVGRYSSSVD
KMMTPYTRPQSNGNREEVRWMSLTDGEKGMTVIAPQKMSFSVSPYTEMELFLADHPHKLP
ATDRNVLHLDLGVTGLGGASCGQGGPLEYDRILAGEHEFKFVIRPASRTNILKPETLKPR
NPSKTISDIDFNPPL

Enzyme Prediction     

No EC number prediction in MGYG000001643_02104.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	77	1012	2.1e-205	0.9680851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	37	1095	15	999	beta-galactosidase.
PRK10340	ebgA	0.0	39	1131	4	1005	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	7.13e-130	76	784	5	637	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	4.94e-84	416	696	4	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	2.75e-76	828	1123	2	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23809.1	0.0	23	1125	25	1122
AIM35762.1	0.0	21	1125	23	1118
AVM57829.1	0.0	21	1127	23	1119
ADV42807.1	0.0	6	1128	5	1126
CDN31503.1	0.0	21	1139	24	1126

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	4.84e-193	37	1137	2	998	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	4.98e-193	37	1137	3	999	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	2.73e-174	51	1125	12	996	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	5.25e-168	51	1125	15	1000	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	1.02e-131	35	1122	1	1019	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.73e-192	37	1137	3	999	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	3.07e-181	27	1098	8	1005	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q6LL68	1.03e-151	38	1125	11	1027	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
P06864	3.16e-148	55	1127	13	1001	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
A1SWB8	4.99e-148	80	1121	45	1028	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000230	0.999157	0.000152	0.000157	0.000145	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001643_02104.