CAZyme Information: MGYG000001643_02932

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000001643_02932
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000001643_134|CGC1	37716.24	4.6643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001643	4013444	MAG	United States	North America

• Gene Location: Start: 3448; End: 4467 Strand: +

Full Sequence      

MNKRTAYAIASIMLASLSQSCATSSKKNADSIPEDSAVTATVSPLKVEGTALLYENGDTA
VLTGPSLGWHSNWQRFYNEGTVKALKEKWGANITRAAIGAHESGDITGTFDADSAKAIAL
ASKVIDAAIDNDMYIICDWHSHDNTIENAKSFFTAITEKYGDSPNIIYEIWNEPLDIPWQ
EIKDYATTIVPLIREKAPNSVIIVGTPKWDQDVDVAAESPLDFKNILYSLHYYAGTHKEW
NRNKAEKAIEAGLPLIISECGSMDHTGDGPIDYESWQEWVDFADRNKLSMLMWDIADKNE
TCSMLSPSAPDNGMEWKDTDLKEWAKLAKKTTRERNSKH

Enzyme Prediction     

No EC number prediction in MGYG000001643_02932.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	56	290	8.9e-87	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.23e-51	53	299	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	0.007	69	234	66	271	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP72662.1	2.46e-181	34	339	31	336
QCD38972.1	2.46e-181	34	339	31	336
AWW31171.1	2.38e-100	42	329	33	316
QDH78944.1	4.26e-99	42	330	33	317
QIK58758.1	7.00e-97	45	336	43	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EGZ_A	1.41e-68	42	309	2	270	ChainA, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_B Chain B, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_C Chain C, ENDOGLUCANASE Z [Dickeya chrysanthemi]
6GJF_A	1.13e-64	45	333	13	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
1TVN_A	1.19e-64	42	323	2	286	Cellulasecel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVN_B Cellulase cel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVP_A Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis],1TVP_B Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis]
5IHS_A	5.61e-64	45	336	35	324	Structureof CHU_2103 from Cytophaga hutchinsonii [Cytophaga hutchinsonii ATCC 33406]
5WH8_A	3.90e-61	45	316	14	293	CellulaseCel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07103	8.61e-67	40	309	43	313	Endoglucanase Z OS=Dickeya dadantii (strain 3937) OX=198628 GN=celZ PE=1 SV=2
P15704	6.38e-61	35	331	37	334	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
O85465	1.81e-58	45	334	38	328	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06565	9.57e-57	34	334	27	328	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P07983	5.07e-56	32	321	23	318	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000075	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001643_02932.