CAZyme Information: MGYG000001645_00119

Basic Information

• Species: Eubacterium_G sp900550135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G; Eubacterium_G sp900550135
• CAZyme ID: MGYG000001645_00119
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000001645_4|CGC1	55325.73	7.4758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001645	2556758	MAG	United States	North America

• Gene Location: Start: 3497; End: 4945 Strand: +

Full Sequence      

MRILHYALGFPPYRTGGLTKYCIDLMLQQKNKGHEVAMMWPGAFSLTGHFVRLKKDKKTV
ENAEIDSYEVINPLPVPLDEGIILTEEFTKKCPNPKVYKEFLEEYKPEAIHIHTLMGLHK
EFVKAAKKLEIPVVFTSHAYFGICPKVTMFRDDKICDGDCSNCFKCNENALSLKKIKILQ
SGLYRTLKDTAVVKKLRKAHRQEFFDEEKAGQDDVELQTPNTPIYENVSKSLLNEKTSGN
QVNQKFEKMVLDGAENRYDKLRKYYMSILSLVDTIHFNSTVTESVYKKFLPKDTNGKVIN
ISHNSIADNRKAKNFDSKELRITYLAPAKNFKGYGIMKQALDEIWIQNSHDVHLTMYNEA
LTNAPYITVNDRFEYSELGNIFDNTDVLIMPSVWYETFGFTVLEALSYGVPVIVSKNVGA
KDLLDDGKYGMIVEPTVEGVKNAVLELISNREKLSWYNNNIVKDFDMEQVLTSDKKIMEL
YK

Enzyme Prediction     

No EC number prediction in MGYG000001645_00119.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	373	452	2e-17	0.49375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03823	GT4_ExpE7-like	3.48e-38	2	448	1	325	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03801	GT4_PimA-like	2.11e-17	246	482	115	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	8.48e-17	260	482	139	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13692	Glyco_trans_1_4	3.27e-14	328	450	11	138	Glycosyl transferases group 1.
cd03814	GT4-like	8.29e-13	377	472	260	358	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK79341.1	6.54e-130	1	477	1	440
BCN32284.1	1.23e-127	1	453	1	420
AGF54981.1	1.21e-109	1	482	1	454
QWH63539.1	3.00e-109	1	482	1	455
QWG58721.1	2.31e-108	1	482	1	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2R60_A	2.66e-07	394	457	367	431	Structureof apo Sucrose Phosphate Synthase (SPS) of Halothermothrix orenii [Halothermothrix orenii],2R66_A Complex Structure of Sucrose Phosphate Synthase (SPS)-F6P of Halothermothrix orenii [Halothermothrix orenii H 168],2R68_A Complex Structure of Sucrose Phosphate Synthase (SPS)-S6P of Halothermothrix orenii [Halothermothrix orenii H 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6LKE9	1.78e-07	364	455	293	383	Probable sucrose-phosphate synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) OX=391009 GN=Tmel_0533 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001645_00119.