CAZyme Information: MGYG000001647_00360

Basic Information

• Species: UMGS1781 sp900553695
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1781; UMGS1781 sp900553695
• CAZyme ID: MGYG000001647_00360
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	MGYG000001647_5|CGC1	93313.13	6.5231

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001647	1184465	MAG	United States	North America

• Gene Location: Start: 49074; End: 51617 Strand: -

Full Sequence      

MEKKKSNSKKAVKRVPNNSTENELDKTKKYKIKTKKHSKAKKIIGITLLLILLVIIVVAG
IFIGKIYGIFKEAKLNISDVIIKYENSVVKDINGNTVAVLSGDENRENVSLSDMSEYLPK
AFVAIEDERFYDHKGVDIKRTGAATIKYALSKIGIGSASYGGSTITQQFLKVLTEEDERT
WQRKVKEMARAYYLEQELSKSQILELYLNLIFLGDRAYGVQVASNYYFSKNAKDLTLAES
AFLAGINDGPNYYNAFSTDENDINKIKRRTKTVVEKMYELGKTNPEHKAAITEEEYNTAI
AEIDNGLAFNKGTITQTVFSYHTDATVTQVKNDLKEKHPDWTNEYLDYYVKSGGLTIYST
QNTEYQKILEEEVKNENYIIHSKKNVDDDGNPVTAQTAMVIIDHTTGYVVATVGGIGEKT
TAFGLNRATQSYRQPGSSAKPIAVLSPGIDAGIITAATVYDDIPYYSGKLNGFKDLGSYQ
GLTTVRFAIAQSKNIPMLKAICDVGIERSAEYLRSIGISVSEEQANMTMALGSVEASPLQ
MAAAYAVIANDGVYIEPTFYTKVVDSDGNVVLEAEQETKTVMSSSAAYVIKEILTEVVRS
GAGWVGNLPGISTAAKTGTSNDDYDRWFCGFSPYYTAATWFGYDQQEYVDVSGNPSGKIW
GAVMKTIHEPLPNKKFSETRPSNVTSATICKASGKLATELCKKDPRGNQVYTEYFIKGTV
PTETCTCHVEVKICPETGLLANEFCPNPETKVFITRPDTETGDWKRAVDAQYMLTIKDTC
TTHKKAEEPAKPEEPEKPNKPEKPNKPEKPNDNTTGGNNTTGGNNTTGGNNTTGGNNTTG
GNNTSRW

Enzyme Prediction     

No EC number prediction in MGYG000001647_00360.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	95	278	4e-58	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.29e-170	105	669	1	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.23e-157	59	694	29	623	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.37e-130	61	751	18	789	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	4.40e-75	64	723	20	830	penicillin-binding protein 1a; Provisional
COG4953	PbpC	3.05e-71	87	757	37	638	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV70266.1	8.19e-154	43	765	29	759
QNU66566.1	1.72e-146	59	786	47	789
AEE96371.1	5.14e-146	59	790	65	810
ADU75447.1	2.28e-145	89	789	78	781
ANV77201.1	2.28e-145	89	789	78	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	4.74e-95	85	758	19	847	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	9.15e-53	194	647	3	436	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
4OON_A	4.18e-52	102	697	35	750	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	1.96e-51	89	645	10	559	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.92e-49	89	645	19	568	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7FY32	2.50e-123	31	774	3	747	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	2.50e-123	31	774	3	747	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7GHV1	3.25e-123	31	774	3	747	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q0TNZ8	1.31e-116	44	751	33	752	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q0SRL7	2.29e-113	87	728	72	724	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999864	0.000142	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
42	64