CAZyme Information: MGYG000001647_00685

Basic Information

• Species: UMGS1781 sp900553695
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1781; UMGS1781 sp900553695
• CAZyme ID: MGYG000001647_00685
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000001647_14|CGC1	40777.72	9.1873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001647	1184465	MAG	United States	North America

• Gene Location: Start: 17095; End: 18150 Strand: +

Full Sequence      

MSKICICGHFGGTKEFLDGQTVKTKNIYMALCQKYGENAVTKLDTYNWKKKPITFLIKCI
RAVKNNGNIIMLPAHNGVKVFVPLFSRLKRLYGKRVMYVVIGGWLPELLQNRNLLKKKIS
KFDKIFVETKIMKNNLEKMNIKNVEILYNFKDIQALKEEELNENYITPLKLCTFSRVMKQ
KGIEDAIRVVEKINEEEKSTIYSLDIFGPIDKDYIEEFEKIQNKFPEYIKYKGCIPSNES
VDVLKDYYLLLFPTRFYTEGIPGTIIDALASGVPVVAANWENCGEILLNDYNSYIYEFEN
IKAFEEILKYTENVDKVIKLKKNALESYKKFDKEVAIKVLTDFIDNKSNAK

Enzyme Prediction     

No EC number prediction in MGYG000001647_00685.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	173	313	2.5e-16	0.85625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	5.76e-20	83	338	95	359	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.39e-17	66	351	98	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03817	GT4_UGDG-like	5.67e-16	111	332	129	360	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03820	GT4_AmsD-like	5.15e-13	121	338	138	347	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03811	GT4_GT28_WabH-like	3.41e-11	60	334	75	348	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALX10015.1	1.17e-107	1	346	1	347
ANV77789.1	1.17e-107	1	346	1	347
ADU75980.1	1.17e-107	1	346	1	347
ABN53541.1	1.17e-107	1	346	1	347
QPI81520.1	3.69e-105	1	346	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F9F_A	1.00e-06	175	331	30	177	CrystalStructure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR29A. [Archaeoglobus fulgidus DSM 4304]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58469	8.76e-08	111	334	149	372	Uncharacterized glycosyltransferase MJ1069 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1069 PE=3 SV=1
P71243	4.97e-06	167	308	221	364	Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Escherichia coli (strain K12) OX=83333 GN=wcaL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001647_00685.