CAZyme Information: MGYG000001647_00794

Basic Information

• Species: UMGS1781 sp900553695
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1781; UMGS1781 sp900553695
• CAZyme ID: MGYG000001647_00794
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	MGYG000001647_19|CGC1	100294.96	8.3766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001647	1184465	MAG	United States	North America

• Gene Location: Start: 2064; End: 4628 Strand: +

Full Sequence      

MDFIKKTWMKFKNKNIQFEKSNEGLKIKNNSEAHGFLAHPYIINNDIKTLKIEFSGKVLK
GNGAILQILDFKRNILCETSFNSQSYFIVNTKKVLFSIKMQRNSEVIIDKINIQFFKEEH
SELEDIIKSPNDVLIITPSYPTEENKYFGGFVHSRVKAYKEAGLKFDLVCAHQYENICKY
SFEGIDVTRTGFRCLREILTSKKYSKILLHFFDGNYAKVLDACDLSGTQLFLWVHGPETL
YWDWSKMTDKYFEAKTELSEEQIEQFKENDKLINRYNNYDNVHWVFVSNWIKEKSEELIN
IKFRNFSVIPNFIDPDNFKFEKKDIELRKNIFFIRRFEDISKYAIDVNVRTILELSRRDF
FKDLQINIYGTGDHYETLIEPIKNFKNVHLYPEFLNHEEIAKVHKENGIGLFATRYDAQG
VSMCEAAMSGLAIASSQNDAIKEFIPEEDGILADTENYVEYANIIEKIYKEPALFTKLSE
DCHNKVYEKCNYDETIQKEIDMIKNEKYVQKKFEPKTENKVLSIIIPSYNVQKYLFHGVY
TMLNHKNANKIQIIIVNDGSKDNTINVAKKLQDTFSEQNITIVDKPNGGHGSTINAGIKV
AKGKYVRIIDGDDWVDSNEMEKLVDTLEKTETDIVITNYCEDRAETNQLIKKHIYDFMVP
GETYYFDDLCYEGYGFGEWGPILATSNFKTEILKNNMPKLTEKCFYIDMEFNAYSIANAQ
TISFYPMYVYKYFIGREGQSISKESYSKNFKQHEKVLFNLIKFYTEANISENKKKYILNK
LILPMITAHYTVLIQFLKSPKEFRKFESKLKVYDAIYNNSKIATRMKKFHRKTRGRFIKC
DNSIKRLKNKIFTR

Enzyme Prediction     

No EC number prediction in MGYG000001647_00794.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	523	654	1.9e-27	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	8.00e-23	523	638	1	114	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.87e-20	524	684	1	148	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd03801	GT4_PimA-like	5.29e-19	133	504	2	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
PRK10073	PRK10073	9.97e-19	522	650	8	136	putative glycosyl transferase; Provisional
cd04179	DPM_DPG-synthase_like	8.67e-18	524	636	1	113	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS67183.1	2.40e-256	52	838	54	852
AJC12300.1	1.15e-94	51	505	53	511
QKF06692.1	2.74e-91	132	694	16	581
AIW87108.1	6.84e-69	132	503	2	370
ANF45136.1	1.30e-67	91	500	115	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.50e-14	520	687	5	158	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	1.59e-13	522	637	7	119	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5TZE_C	6.64e-09	523	742	4	212	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	1.09e-08	523	742	4	212	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
2Z86_A	2.00e-08	510	629	363	481	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR96	2.47e-14	519	669	2	144	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P71057	7.36e-14	518	754	2	235	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
P71059	4.23e-13	521	635	4	115	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
P47306	2.66e-12	522	761	3	234	Uncharacterized glycosyltransferase MG060 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) OX=243273 GN=MG060 PE=3 SV=1
Q68X33	1.94e-11	517	664	5	142	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001647_00794.